This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MyBioSource
product type :
protein
product name :
Recombinant Escherichia coli Outer membrane protein X (ompX)
catalog :
MBS1199981
quantity :
1 mg (E Coli Derived
price :
1255 USD
product information
catalog number :
MBS1199981
products type :
Recombinant Protein
products full name :
Recombinant Escherichia coli Outer membrane protein X (ompX)
products short name :
Outer membrane protein X (ompX)
products name syn :
Recombinant Outer membrane protein X (ompX); Outer membrane protein X
other names :
outer membrane protein X; Outer membrane protein X; outer membrane protein X
products gene name syn :
ompX; ybiG
other gene names :
ompX; ompX; ECK0803; JW0799; ybiG; ybiG
uniprot entry name :
OMPX_ECOLI
host :
E Coli or Yeast
sequence positions :
24-171
sequence length :
171
sequence :
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGV
IGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWAS
IYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNP
MENVALDFSYEQSRIRSVDVGTWIAGVGYRF
purity :
>90%
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Escherichia coli (strain K12)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi gi num :
16128782
ncbi acc num :
NP_415335.1
ncbi gb acc num :
NC_000913.2
uniprot acc num :
P0A917
ncbi mol weight :
18,603 Da
ncbi summary :
ompX is nduced by acid or base. [More information is available at EcoGene: EG12135]. OmpX is a small (18 kDa) outer-membrane protein (OMP). [More information is available at EcoCyc: EG12117].
uniprot summary :
Subcellular location: Cell outer membrane; Multi-pass membrane protein. Sequence similarities: Belongs to the Ail/OmpX/PagC/Lom family.
size :
1 mg (E Coli Derived)
price :
1255 USD
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!