catalog number :
MBS1199359
products type :
Recombinant Protein
products full name :
Recombinant Escherichia coli FKBP-type peptidyl-prolyl cis-trans isomerase fkpA (fkpA)
products short name :
[FKBP-type peptidyl-prolyl cis-trans isomerase fkpA (fkpA)]
other names :
[FKBP-type peptidyl-prolyl cis-trans isomerase (rotamase); FKBP-type peptidyl-prolyl cis-trans isomerase FkpA; FKBP-type peptidyl-prolyl cis-trans isomerase (rotamase); Rotamase]
products gene name :
[fkpA]
other gene names :
[fkpA; fkpA; ECK3334; JW3309; yzzS; yzzS; PPIase]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[26-270. Full Length of Mature Protein]
sequence :
AEAAKPATAADSKAAFKNDDQKSAYALGASLGRYMENSL
KEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQ
AFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVK
TSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEF
DNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIP
PELAYGKAGVPGIPPNSTLVFDVELLDVKPAPKADAKPE
ADAKAADSAKK
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-Page
other info1 :
Species: Escherichia coli (strain K12)
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol. Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
ncbi acc num :
NP_417806.1
ncbi gb acc num :
NC_000913.3
ncbi mol weight :
28,882 Da
ncbi summary :
An fkpA, surA, ppiB, ppiD quadruple mutant is viable. [More information is available at EcoGene: EG12900]. FkpA is a heat shock peptidyl-prolyl isomerase (PPIase) which also has chaperone function. [More information is available at EcoCyc: G7716].
uniprot summary :
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
size6 :
0.05 mg (Baculovirus)
size10 :
0.05 mg (Mammalian-Cell)
size11 :
0.1 mg (Baculovirus)
size13 :
0.5 mg (Baculovirus)
size15 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)