Recombinant Human Transmembrane protease serine 2 | MyBioSource MBS1193731 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Transmembrane protease serine 2

catalog :

MBS1193731

quantity :

0.01 mg (E-Coli)

price :

125 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1193731

products type :

Recombinant Protein

products full name :

Recombinant Human Transmembrane protease serine 2

products short name :

Transmembrane protease serine 2

products name syn :

Serine protease 10

other names :

transmembrane protease serine 2 isoform 1; Transmembrane protease serine 2; transmembrane protease serine 2; transmembrane protease, serine 2; Serine protease 10

products gene name :

TMPRSS2

other gene names :

TMPRSS2; TMPRSS2; PP9284; PRSS10; PRSS10

uniprot entry name :

TMPS2_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

106-492

sequence length :

529

sequence :

WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGED
ENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRA
ACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIY
KKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGES
ALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEK
PLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDS
KTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQL
CWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYD
NLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLI
GDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

other info2 :

Species: Homo sapiens (Human)

products categories :

Cancer

products description :

Serine protease that proteolytically cleaves and activates the viral spike glycoproteins which facilitate virus-cell membrane fusions; spike proteins are synthesized and maintained in precursor intermediate folding states and proteolysis permits the refolding and energy release required to create stable virus-cell linkages and membrane coalescence. Facilitates human SARS coronavirus (SARS-CoV) infection via two independent mechanisms, proteolytic cleavage of ACE2, which might promote viral uptake, and cleavage of coronavirus spike glycoprotein which activates the glycoprotein for cathepsin L-independent host cell entry. Proteolytically cleaves and activates the spike glycoproteins of human coronavirus 229E (HCoV-229E) and human coronavirus EMC (HCoV-EMC) and the fusion glycoproteins F0 of Sendai virus (SeV), human metapneumovirus (HMPV), human parainfluenza 1, 2, 3, 4a and 4b viruses (HPIV). Essential for spread and pathogenesis of influenza A virus (strains H1N1, H3N2 and H7N9); involved in proteolytic cleavage and activation of hemagglutinin (HA) protein which is essential for viral infectivity.

products references :

Cloning of the TMPRSS2 gene, which encodes a novel serine protease with transmembrane, LDLRA, and SRCR domains and maps to 21q22.3." Paoloni-Giacobino A., Chen H., Peitsch M.C., Rossier C., Antonarakis S.E. Genomics 44:309-320(1997)

ncbi gi num :

227499990

ncbi acc num :

NP_001128571.1

ncbi gb acc num :

NM_001135099.1

uniprot acc num :

O15393

ncbi mol weight :

44.82KD

ncbi pathways :

Coregulation Of Androgen Receptor Activity Pathway (138085); Influenza A Pathway (217173); Influenza A Pathway (217150); Regulation Of Androgen Receptor Activity Pathway (138027); Transcriptional Misregulation In Cancer Pathway (523016); Transcriptional Misregulation In Cancer Pathway (522987)

ncbi summary :

This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a type II transmembrane domain, a receptor class A domain, a scavenger receptor cysteine-rich domain and a protease domain. Serine proteases are known to be involved in many physiological and pathological processes. This gene was demonstrated to be up-regulated by androgenic hormones in prostate cancer cells and down-regulated in androgen-independent prostate cancer tissue. The protease domain of this protein is thought to be cleaved and secreted into cell media after autocleavage. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2008]

uniprot summary :

TMPRSS2: a protein that belongs to the serine protease family. The encoded protein contains a type II transmembrane domain, a receptor class A domain, a scavenger receptor cysteine-rich domain and a protease domain. Serine proteases are known to be involved in many physiological and pathological processes. This gene was demonstrated to be up-regulated by androgenic hormones in prostate cancer cells and down-regulated in androgen-independent prostate cancer tissue. The protease domain of this protein is thought to be cleaved and secreted into cell media after autocleavage. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2008]. Protein type: EC 3.4.21.-; Membrane protein, integral; Protease. Chromosomal Location of Human Ortholog: 21q22.3. Cellular Component: integral to plasma membrane; plasma membrane. Molecular Function: protein binding; scavenger receptor activity; serine-type endopeptidase activity; serine-type peptidase activity. Biological Process: positive regulation of virion penetration into host cell; protein autoprocessing; proteolysis; receptor-mediated endocytosis

size1 :

0.01 mg (E-Coli)

price1 :

125 USD

size2 :

0.05 mg (E-Coli)

price2 :

220

size3 :

0.2 mg (E-Coli)

price3 :

560

size4 :

0.5 mg (E-Coli)

price4 :

920

size5 :

0.05 mg (Baculovirus)

price5 :

1155

more info or order :

MyBioSource product webpage