ELLKQYGGADWEKDAKKMIVLALTRGNKPRRMMMKMSKE
GKATVEALINKYKLKEGNPSRDELTLSRVAAALAGWTCQ
ALVVLSEWLPVTGTTMDGLSPAYPRHMMHPSFAGMVDPS
LPGDYLRAILDAHSLYLLQFSRVINPNLRGRTKEEVAAT
FTQPMNAAVNSNFISHEKRREFLKAFGLVDSNGKPSAAV
MAAAQAYKTAA

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Macaca fascicularis Interleukin-10 (IL10) | MBS1198149
- Recombinant Human papillomavirus type 16 Protein E6 | MBS1200699
- Recombinant Zaire ebolavirus Nucleoprotein (NP) | MBS1206629
- Recombinant Mouse Regenerating islet-derived protein 3-gamma | MBS1213774
- Recombinant Human Transient receptor potential cation channel subfamily A member ...
