product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin
catalog :
MBS1191893
quantity :
0.01 mg (E-Coli)
price :
235 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1191893
products type :
Recombinant Protein
products full name :
Recombinant Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin
products short name :
[Thrombin-like enzyme contortrixobin]
other names :
[Thrombin-like enzyme contortrixobin; Thrombin-like enzyme contortrixobin; Fibrinogen-clotting enzyme; Snake venom serine protease; SVSP; Venombin B]
other gene names :
[SVTLE; SVSP]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-234aa; Full Length]
sequence length :
234
sequence :
VVGGDECNINEHRFLVAIFNSNGFVCSGTLINQEWVLTA
AHCDSTDFQIKLGAHSKKVLNEDEQIRNPKEKFICPNKK
NDEVLDKDIMLIKLDSRVSNSEHIAPLSLPSSPPSVGSV
CHIMGWGSITPIEVTFPDVPHCAYINLLDDAACQPGYPE
VLPEYRTLCAGILEGGKDTCNYDSGGPLICNGQFQGIVS
YGAHPCGQSLKPGIYTKVFDYNDWIQSIIAGNTAATCPP
purity :
>85% (SDS-PAGE)
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Agkistrodon contortrix contortrix (Southern copperhead)
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol. Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
ncbi gi num :
32469800
ncbi acc num :
P82981.1
uniprot acc num :
P82981
ncbi mol weight :
25,413 Da
ncbi pathways :
Focal Adhesion Pathway (83067); Focal Adhesion Pathway (478); MAPK Signaling Pathway (83048); MAPK Signaling Pathway (456); Salmonella Infection Pathway (375172); Salmonella Infection Pathway (375149)
uniprot summary :
Thrombin-like snake venom serine protease that cleaves beta chain of fibrinogen (FGB), releasing fibrinopeptide B. Has a coagulant activity activating blood coagulation factors V (F5) and XIII (F13A1).
size1 :
0.01 mg (E-Coli)
price1 :
235 USD
size2 :
0.05 mg (E-Coli)
price2 :
320
size3 :
0.1 mg (E-Coli)
price3 :
535
size4 :
0.2 mg (E-Coli)
price4 :
855
size5 :
0.5 mg (E-Coli)
price5 :
1125
size6 :
1 mg (E-Coli)
price6 :
1725
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!