Recombinant Rat Protein S100-A9 (S100a9) | MyBioSource MBS1191181 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Rat Protein S100-A9 (S100a9)

catalog :

MBS1191181

quantity :

0.01 mg (E-Coli)

price :

200 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1191181

products type :

Recombinant Protein

products full name :

Recombinant Rat Protein S100-A9 (S100a9)

products short name :

[Protein S100-A9 (S100a9)]

products name syn :

[Protein S100-A9; Calgranulin-B; Migration inhibitory factor-related protein 14; MRP-14; p14; Myeloid-related protein 14; S100 calcium-binding protein A9]

other names :

[protein S100-A9; Protein S100-A9; protein S100-A9; p14; MRP-14; calgranulin-B; myeloid-related protein 14; intracellular calcium-binding protein (MRP14); migration inhibitory factor-related protein 14; S100 calcium binding protein A9 (calgranulin B); S100 calcium-binding protein A9 (calgranulin B); S100 calcium binding protein A9; Calgranulin-B; Migration inhibitory factor-related protein 14; MRP-14; p14; Myeloid-related protein 14; S100 calcium-binding protein A9]

products gene name :

[S100a9]

products gene name syn :

[S100a9; Mrp14]

other gene names :

[S100a9; S100a9; Mrp14; Mrp14; MRP-14; p14]

uniprot entry name :

S10A9_RAT

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

[2-113aa; Full Length of Mature Protein]

sequence length :

113

sequence :

AAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKE
MVNKDLPNFLKREKRNENLLRDIMEDLDTNQDNQLSFEE
CMMLMGKLIFACHEKLHENNPRGHDHSHGKGCGK

purity :

>=90%

form :

Liquid containing glycerol

storage stability :

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

image1 heading :

SDS-Page

other info1 :

Species: Rattus norvegicus (Rat)

other info2 :

Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.

products categories :

Immunology

products description :

S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and Extracellular domain functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The Extracellular domain functions involve proinfammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its proinflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the proinflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn2+ which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. The iNOS-S100A8/A9 transnitrosylase complex is proposed to direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as GAPDH, NXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif (By similarity).

ncbi gi num :

16758364

ncbi acc num :

NP_446039.1

ncbi gb acc num :

NM_053587.1

uniprot acc num :

P50116

ncbi mol weight :

13,145 Da

ncbi summary :

calcium binding protein that may be associated with acute inflammatory processes [RGD, Feb 2006]

uniprot summary :

S100A9: a calcium-binding regulatory protein of the S-100 family expressed by macrophages in acutely inflammated tissues and in chronic inflammations. May be an inhibitor of protein kinases. Also expressed in epithelial cells constitutively or induced during dermatoses. May interact with components of the intermediate filaments in monocytes and epithelial cells. Interacts with CEACAM3 in a calcium-dependent manner. Protein type: Motility/polarity/chemotaxis; Cytoskeletal; Calcium-binding. Cellular Component: extracellular space; cytoskeleton; cytoplasm; plasma membrane; nucleus. Molecular Function: arachidonic acid binding; antioxidant activity; RAGE receptor binding; zinc ion binding; microtubule binding; calcium ion binding. Biological Process: caspase activation; neutrophil chemotaxis; chronic inflammatory response; response to ethanol; response to zinc ion; leukocyte chemotaxis; actin cytoskeleton reorganization; innate immune response; autophagy; positive regulation of peptide secretion; response to lipopolysaccharide; regulation of integrin biosynthetic process; leukocyte migration during inflammatory response; positive regulation of inflammatory response

size1 :

0.01 mg (E-Coli)

price1 :

200 USD

size2 :

0.05 mg (E-Coli)

price2 :

260

size3 :

0.1 mg (E-Coli)

price3 :

430

size4 :

0.2 mg (E-Coli)

price4 :

685

size5 :

0.5 mg (E-Coli)

price5 :

1125

size6 :

1 mg (E-Coli)

price6 :

1725

more info or order :

MyBioSource product webpage