product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Gamma-aminobutyric acid receptor subunit beta-2 (GABRB2)
catalog :
MBS1191031
quantity :
1 mg (E-Coli)
price :
1420 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1191031
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Gamma-aminobutyric acid receptor subunit beta-2 (GABRB2)
products short name :
(Rhesus macaque) Gamma-aminobutyric acid receptor subunit beta-2 (GABRB2)
products name syn :
Recombinant (Rhesus macaque) Gamma-aminobutyric acid receptor subunit beta-2 (GABRB2); Gamma-aminobutyric acid receptor subunit beta-2; GABA(A) receptor subunit beta-2
other names :
gamma-aminobutyric acid receptor subunit beta-2; Gamma-aminobutyric acid receptor subunit beta-2; gamma-aminobutyric acid receptor subunit beta-2; GABA(A) receptor subunit beta-2; gamma-aminobutyric acid A receptor beta 2; GABA(A) receptor subunit beta-2
products gene name syn :
GABRB2
other gene names :
GABRB2; GABRB2
uniprot entry name :
GBRB2_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
26-244
sequence length :
512
sequence :
SVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGM
NIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPL
NLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRL
HPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESY
GYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITK
KVVFSTGSYPRLSLSFKLKRNIGY
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
ncbi gi num :
270047479
ncbi acc num :
NP_001161800.1
ncbi gb acc num :
NM_001168328.1
uniprot acc num :
D1LYT2
ncbi mol weight :
59,150 Da
ncbi pathways :
GABAergic Synapse Pathway (377275); GABAergic Synapse Pathway (377129); Morphine Addiction Pathway (552685); Morphine Addiction Pathway (554808); Neuroactive Ligand-receptor Interaction Pathway (86723); Neuroactive Ligand-receptor Interaction Pathway (462); Nicotine Addiction Pathway (583267); Nicotine Addiction Pathway (584676); Retrograde Endocannabinoid Signaling Pathway (537752); Retrograde Endocannabinoid Signaling Pathway (539806)
uniprot summary :
Function: GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel. Subunit structure: Generally pentameric. There are five types of GABA(A) receptor chains: alpha, beta, gamma, delta, and rho. Binds UBQLN1. Interacts with KCTD8, KCTD12 and KCTD16; this interaction determines the pharmacology and kinetics of the receptor response, the KCTD proteins markedly accelerating the GABA-B response, although to different extents . By similarity. Subcellular location: Cell junction synapse postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Sequence similarities: Belongs to the ligand-gated ion channel (TC 1.A.9) family. Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily. GABRB2 sub-subfamily. [View classification]
size1 :
1 mg (E-Coli)
price1 :
1420 USD
size2 :
1 mg (Yeast)
price2 :
1875
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!