protein

Recombinant Mouse Bis(5'-adenosyl)-triphosphatase

MBS1190465

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Mouse Bis(5'-adenosyl)-triphosphatase

Bis(5'-adenosyl)-triphosphatase

AP3A hydrolase; AP3; Aase; Diadenosine 5',5'''-P1,P3-triphosphate hydrolase; Dinucleosidetriphosphatase; Fragile histidine triad protein

bis(5'-adenosyl)-triphosphatase isoform 2; Bis(5'-adenosyl)-triphosphatase; bis(5'-adenosyl)-triphosphatase; fragile histidine triad gene; AP3A hydrolase; AP3Aase; Diadenosine 5',5'''-P1,P3-triphosphate hydrolase; Dinucleosidetriphosphatase; Fragile histidine triad protein

Fhit

Fhit; Fhit; Fra14A2; AW045638; AP3Aase

FHIT_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

2-150

150

SFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCP
LRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSIT
FSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQ
KHDREEEDSPAFWRSEKEMAAEAEALRVYFQA

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Cleaves P(1)-P(3)-bis(5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP. Can also hydrolyze P(1)-P(4)-bis(5'-adenosyl) tetraphosphate (Ap4A), but has extrely low activity with ATP. Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5. Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways. Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis. Induction of apoptosis depends on the ability of FHIT to bind P(1)-P(3)-bis(5'-adenosyl) triphosphate or related compounds, but does not require its catalytic activity. Functions as tumor suppressor.

The murine Fhit locus isolation, characterization, and expression in normal and tumor cells.Pekarsky Y., Druck T., Cotticelli M.G., Ohta M., Shou J., Mendrola J., Montgomery J.C., Buchberg A.M., Siracusa L.D., Manenti G., Fong L.Y., Dragani T.A., Croce C.M., Huebner K.Cancer Res. 58:3401-3408(1998) Nitrilase and Fhit homologs are encoded as fusion proteins in Drosophila melanogaster and Caenorhabditis elegans.Pekarsky Y., Campiglio M., Siprashvili Z., Druck T., Sedkov Y., Tillib S., Draganescu A., Wermuth P., Rothman J.H., Huebner K., Buchberg A.M., Mazo A., Brenner C., Croce C.M.Proc. Natl. Acad. Sci. U.S.A. 95:8744-8749(1998) Muir-Torre-like syndrome in Fhit-deficient mice.Fong L.Y., Fidanza V., Zanesi N., Lock L.F., Siracusa L.D., Mancini R., Siprashvili Z., Ottey M., Martin S.E., Druck T., McCue P.A., Croce C.M., Huebner K.Proc. Natl. Acad. Sci. U.S.A. 97:4742-4747(2000) The tumor spectrum in FHIT-deficient mice.Zanesi N., Fidanza V., Fong L.Y., Mancini R., Druck T., Valtieri M., Rudiger T., McCue P.A., Croce C.M., Huebner K.Proc. Natl. Acad. Sci. U.S.A. 98:10250-10255(2001)

815930058

NP_001295215.1

NM_001308286.1

O89106

21.2kD

Non-small Cell Lung Cancer Pathway (83312); Non-small Cell Lung Cancer Pathway (531); Purine Metabolism Pathway (83144); Purine Metabolism Pathway (672434); Purine Metabolism Pathway (307); Small Cell Lung Cancer Pathway (83311); Small Cell Lung Cancer Pathway (530)

This gene encodes a member of the HIT family of proteins that are characterized by the presence of a histidine triad sequence. The encoded protein is a diadenosine triphosphate hydrolase enzyme that cleaves the P(1)-P(3)-bis(5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP. This locus is very fragile and has been found to be altered in different types of cancers. Mice lacking the encoded protein display increased susceptibility to spontaneous and induced tumors. Ectopic expression of the encoded protein in such knockout mice inhibits tumor development. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015]

FHIT: a member of the histidine triad gene family. A diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. Its gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. A possible tumor suppressor in specific tissues. Phospho-FHIT observed in liver and kidney, but not in brain and lung. Phospho-FHIT undetected in all tested human tumor cell lines. Aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. Protein type: Motility/polarity/chemotaxis; Tumor suppressor; Hydrolase; DNA replication; EC 3.6.1.29; Nucleotide Metabolism - purine. Cellular Component: cytoplasm; cytosol; intracellular; nucleus; plasma membrane. Molecular Function: bis(5'-adenosyl)-triphosphatase activity; catalytic activity; hydrolase activity; identical protein binding; nickel ion binding; nucleotide binding; ubiquitin protein ligase binding. Biological Process: apoptosis; diadenosine triphosphate catabolic process; DNA replication; negative regulation of proteasomal ubiquitin-dependent protein catabolic process; nucleotide metabolic process; purine nucleotide metabolic process; regulation of transcription, DNA-dependent; transcription, DNA-dependent

0.05 mg (E-Coli)

190 USD

0.05 mg (Yeast)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (Yeast)

750