product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Neosartorya fumigata Ribonuclease mitogillin (mitF)
catalog :
MBS1189059
quantity :
0.01 mg (E-Coli)
price :
235 USD
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS1189059 image 1
product information
catalog number :
MBS1189059
products type :
Recombinant Protein
products full name :
Recombinant Neosartorya fumigata Ribonuclease mitogillin (mitF)
products short name :
[Ribonuclease mitogillin (mitF)]
products name syn :
[Ribonuclease mitogillin; EC=3.1.27.-; Allergen Asp f I; Allergen I/a; IgE-binding ribotoxin; Major allergen Asp f 1; Allergen=; Asp f 1]
other names :
[major allergen and cytotoxin AspF1; Ribonuclease mitogillin; major allergen and cytotoxin AspF1; Allergen Asp f I; Allergen I/a; IgE-binding ribotoxin; Major allergen Asp f 1; Allergen: Asp f 1]
products gene name :
[mitF]
products gene name syn :
[mitF; aspF1; AFUA_5G02330]
other gene names :
[AFUA_5G02330; mitF; aspF1]
uniprot entry name :
RNMG_ASPFU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[28-176aa; Full Length of Mature Protein]
sequence length :
176
sequence :
ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLS
DGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRP
PKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPG
PARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
purity :
>=90%
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-Page
other info1 :
Species: Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
other info2 :
Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
ncbi gi num :
70985206
ncbi acc num :
XP_748109.1
ncbi gb acc num :
XM_743016.1
uniprot acc num :
P67875
ncbi mol weight :
19,595 Da
uniprot summary :
This purine-specific ribonuclease cleaves 28S RNA in eukaryotic ribosomes, inhibits protein synthesis, and shows antitumor activity.
size1 :
0.01 mg (E-Coli)
price1 :
235 USD
size2 :
0.05 mg (E-Coli)
price2 :
320
size3 :
0.1 mg (E-Coli)
price3 :
535
size4 :
0.2 mg (E-Coli)
price4 :
855
size5 :
0.5 mg (E-Coli)
price5 :
1125
size6 :
1 mg (E-Coli)
price6 :
1725
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!