product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Bacillus subtilis Glycine oxidase
catalog :
MBS1186935
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS1186935
products type :
Recombinant Protein
products full name :
Recombinant Bacillus subtilis Glycine oxidase
products short name :
Glycine oxidase
other names :
glycine oxidase; Glycine oxidase; glycine oxidase
products gene name :
thiO
other gene names :
thiO; thiO; goxB; yjbR; GO
uniprot entry name :
GLOX_BACSU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-369, Full length.
sequence length :
369
sequence :
MKRHYEAVVIGGGIIGSAIAYYLAKENKNTALFESGTMG
GRTTSAAAGMLGAHAECEERDAFFDFAMHSQRLYKGLGE
ELYALSGVDIRQHNGGMFKLAFSEEDVLQLRQMDDLDSV
SWYSKEEVLEKEPYASGDIFGASFIQDDVHVEPYFVCKA
YVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWA
NHVVVASGVWSGMFFKQLGLNNAFLPVKGECLSVWNDDI
PLTKTLYHDHCYIVPRKSGRLVVGATMKPGDWSETPDLG
GLESVMKKAKTMLPAIQNMKVDRFWAGLRPGTKDGKPYI
GRHPEDSRILFAAGHFRNGILLAPATGALISDLIMNKEV
NQDWLHAFRIDRKEAVQI
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Catalyzes the FAD-dependent oxidative deamination of various amines and D-amino acids to yield the corresponding alpha-keto acids, ammonia/amine, and hydrogen peroxide. Oxidizes sarcosine (N-methylglycine), N-ethylglycine and glycine. Can also oxidize the herbicide glyphosate (N-phosphonomethylglycine). Displays lower activities on D-alanine, D-valine, D-proline and D-methionine. Does not act on L-amino acids and other D-amino acids. Is essential for thiamine biosynthesis since the oxidation of glycine catalyzed by ThiO generates the glycine imine intermediate (dehydroglycine) required for the biosynthesis of the thiazole ring of thiamine pyrophosphate.
products references :
The complete genome sequence of the Gram-positive bacterium Bacillus subtilis.Kunst F., Ogasawara N., Moszer I., Albertini A.M., Alloni G., Azevedo V., Bertero M.G., Bessieres P., Bolotin A., Borchert S., Borriss R., Boursier L., Brans A., Braun M., Brignell S.C., Bron S., Brouillet S., Bruschi C.V., Caldwell B., Capuano V., Carter N.M., Choi S.-K., Codani J.-J., Connerton I.F., Cummings N.J., Daniel R.A., Denizot F., Devine K.M., Duesterhoeft A., Ehrlich S.D., Emmerson P.T., Entian K.-D., Errington J., Fabret C., Ferrari E., Foulger D., Fritz C., Fujita M., Fujita Y., Fuma S., Galizzi A., Galleron N., Ghim S.-Y., Glaser P., Goffeau A., Golightly E.J., Grandi G., Guiseppi G., Guy B.J., Haga K., Haiech J., Harwood C.R., Henaut A., Hilbert H., Holsappel S., Hosono S., Hullo M.-F., Itaya M., Jones L.-M., Joris B., Karamata D., Kasahara Y., Klaerr-Blanchard M., Klein C., Kobayashi Y., Koetter P., Koningstein G., Krogh S., Kumano M., Kurita K., Lapidus A., Lardinois S., Lauber J., Lazarevic V., Lee S.-M., Levine A., Liu H., Masuda S., Mauel C., Medigue C., Medina N., Mellado R.P., Mizuno M., Moestl D., Nakai S., Noback M., Noone D., O'Reilly M., Ogawa K., Ogiwara A., Oudega B., Park S.-H., Parro V., Pohl T.M., Portetelle D., Porwollik S., Prescott A.M., Presecan E., Pujic P., Purnelle B., Rapoport G., Rey M., Reynolds S., Rieger M., Rivolta C., Rocha E., Roche B., Rose M., Sadaie Y., Sato T., Scanlan E., Schleich S., Schroeter R., Scoffone F., Sekiguchi J., Sekowska A., Seror S.J., Serror P., Shin B.-S., Soldo B., Sorokin A., Tacconi E., Takagi T., Takahashi H., Takemaru K., Takeuchi M., Tamakoshi A., Tanaka T., Terpstra P., Tognoni A., Tosato V., Uchiyama S., Vandenbol M., Vannier F., Vassarotti A., Viari A., Wambutt R., Wedler E., Wedler H., Weitzenegger T., Winters P., Wipat A., Yamamoto H., Yamane K., Yasumoto K., Yata K., Yoshida K., Yoshikawa H.-F., Zumstein E., Yoshikawa H., Danchin A.Nature 390:249-256(1997) Purification and characterization of a novel glycine oxidase from Bacillus subtilis.Nishiya Y., Imanaka T.FEBS Lett. 438:263-266(1998) Glycine oxidase from Bacillus subtilis. Characterization of a new flavoprotein.Job V., Marcone G.L., Pilone M.S., Pollegioni L.J. Biol. Chem. 277:6985-6993(2002) Structural and mechanistic studies on ThiO, a glycine oxidase essential for thiamin biosynthesis in Bacillus subtilis.Settembre E.C., Dorrestein P.C., Park J.-H., Augustine A.M., Begley T.P., Ealick S.E.Biochemistry 42:2971-2981(2003) Structure-function correlation in glycine oxidase from Bacillus subtilis.Moertl M., Diederichs K., Welte W., Molla G., Motteran L., Andriolo G., Pilone M.S., Pollegioni L.J. Biol. Chem. 279:29718-29727(2004) Glyphosate resistance by engineering the flavoenzyme glycine oxidase.Pedotti M., Rosini E., Molla G., Moschetti T., Savino C., Vallone B., Pollegioni L.J. Biol. Chem. 284:36415-36423(2009)
ncbi gi num :
16078232
ncbi acc num :
NP_389049.1
ncbi gb acc num :
NC_000964.3
uniprot acc num :
O31616
ncbi mol weight :
56.9kD
ncbi pathways :
Metabolic Pathways (131999); Thiamine Metabolism Pathway (1371); Thiamine Metabolism Pathway (397); Butanol And Isobutanol Biosynthesis (engineered) Pathway (982185); Superpathway Of Thiamin Diphosphate Biosynthesis II (546654); Superpathway Of Thiamine Diphosphate Biosynthesis II (547518); Thiazole Biosynthesis II (Bacillus) Pathway (546653); Thiazole Biosynthesis II (aerobic Bacteria) Pathway (547517)
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
950
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1170
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!