
SVSNKEVEAPTSETKEAKEVKEVKAPKETKEVKPAAKAT
NNTYPILNQELREAIKNPAIKDKDHSAPNSRPIDFEMKK
KDGTQQFYHYASSVKPARVIFTDSKPEIELGLQSGQFWR
KFEVYEGDKKLPIKLVSYDTVKDYAYIRFSVSNGTKAVK
IVSSTHFNNKEEKYDYTLMEFAQPIYNSADKFKT

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Escherichia coli Beta-lactamase (ampC) | MBS1182578
- Recombinant Neosartorya fumigata Ribonuclease mitogillin (mitF) | MBS1189059
- Recombinant Rat Protein S100-A9 (S100a9) | MBS1191181
- Recombinant Myrmecia pilosula Pilosulin-3b | MBS1191535
- Recombinant Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobi ...