product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Guanylate cyclase activator 2B
catalog :
MBS1181049
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1181049
products type :
Recombinant Protein
products full name :
Recombinant Mouse Guanylate cyclase activator 2B
products short name :
Guanylate cyclase activator 2B
other names :
guanylate cyclase activator 2B preproprotein; Guanylate cyclase activator 2B; guanylate cyclase activator 2B; guanylate cyclase activator 2b (retina)
products gene name :
Guca2b
other gene names :
Guca2b; Guca2b; Ugn; Gcap2; AV066530; UGN
uniprot entry name :
GUC2B_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
22-106
sequence length :
106
sequence :
VYIKYHGFQVQLESVKKLNELEEKEMSNPQPRRSGLLPA
VCHNPALPLDLQPVCASQEAASTFKALRTIATDECELCI
NVACTGC
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.
products references :
Uroguanylin and guanylin distinct but overlapping patterns of messenger RNA expression in mouse intestine.Whitaker T.L., Witte D.P., Scott M.C., Cohen M.B.Gastroenterology 113:1000-1006(1997) Sanford L.P., Cohen M.B.
ncbi gi num :
160298221
ncbi acc num :
NP_032217.2
ncbi gb acc num :
NM_008191.2
uniprot acc num :
O09051
ncbi mol weight :
36.8kD
ncbi pathways :
Myometrial Relaxation And Contraction Pathways (198333)
ncbi summary :
This gene encodes a member of the guanylin family and preproprotein that is proteolytically processed to generate a mature protein product. The mature protein product, known as uroguanylin, is an endogenous ligand for the guanylate cyclase-C receptor and may regulate salt and water homeostasis in the intestine and kidneys. Homozygous knockout mice for this gene exhibit impaired sodium chloride excretion and elevated arterial pressure. This gene is present in a gene cluster with a related guanylin family member on chromosome 4. [provided by RefSeq, Sep 2015]
uniprot summary :
GUCA2B: Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport. Belongs to the guanylin family. Protein type: Secreted; Secreted, signal peptide. Cellular Component: extracellular region; photoreceptor outer segment. Molecular Function: guanylate cyclase activator activity. Biological Process: body fluid secretion; cGMP biosynthetic process; excretion; negative regulation of blood pressure; regulation of cyclic nucleotide biosynthetic process
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (E-Coli)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!