product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Myc proto-oncogene protein (MYC)
catalog :
MBS1180744
quantity :
1 mg (E-Coli)
price :
1920 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1180744
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Myc proto-oncogene protein (MYC)
products short name :
(Rhesus macaque) Myc proto-oncogene protein (MYC)
products name syn :
Recombinant (Rhesus macaque) Myc proto-oncogene protein (MYC); Myc proto-oncogene protein; Proto-oncogene c-Myc Transcription factor p64
other names :
myc proto-oncogene protein; Myc proto-oncogene protein; myc proto-oncogene protein; proto-oncogene c-Myc; transcription factor p64; Proto-oncogene c-Myc; Transcription factor p64
products gene name syn :
MYC
other gene names :
MYC; MYC; c-Myc
uniprot entry name :
MYC_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-439
sequence length :
439
sequence :
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSE
LQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVT
PFSPRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFIC
DPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAAR
KDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVF
PYPLNDSSSPKSCASPDSSAFSPSSDSLLSSTESSPQAS
PEPLVLHEETPPTTSSDSEEEQEEEEEIDVVSVEKRQAP
GKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAP
PSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTE
ENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKA
PKVVILKKATAYILSVQAEEQKLISEKDLLRKRREQLKH
KLEQLRNSCA
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
ncbi gi num :
218847750
ncbi acc num :
NP_001136345.1
ncbi gb acc num :
NM_001142873.1
uniprot acc num :
B8XIA5
ncbi mol weight :
48,800 Da
ncbi pathways :
Acute Myeloid Leukemia Pathway (86783); Acute Myeloid Leukemia Pathway (529); Bladder Cancer Pathway (86781); Bladder Cancer Pathway (527); Cell Cycle Pathway (86724); Cell Cycle Pathway (463); Chronic Myeloid Leukemia Pathway (86782); Chronic Myeloid Leukemia Pathway (528); Colorectal Cancer Pathway (86772); Colorectal Cancer Pathway (518)
uniprot summary :
Function: Participates in the regulation of gene transcription. Binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Seems to activate the transcription of growth-related genes . By similarity. Subunit structure: Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MAX. Interacts with TAF1C and SPAG9. Interacts with PARP10. Interacts with KDM5A and KDM5B. Interacts (when phosphorylated at Thr-58 and Ser-62) with FBXW7 . By similarity. Interacts with PIM2 . By similarity. Interacts with NO66 . By similarity. Subcellular location: Nucleus nucleoplasm . By similarity. Nucleus nucleolus . By similarity. Post-translational modification: Phosphorylated by PRKDC. Phosphorylation at Thr-58 and Ser-62 by GSK3 is required for ubiquitination and degradation by the proteasome . By similarity. Phosphorylation at Ser-329 by PIM2 leads to the stabilization of MYC. Phosphorylation at Ser-62 by CDK2 prevents Ras-induced senescence . By similarity.Ubiquitinated by the SCF(FBXW7) complex when phosphorylated at Thr-58 and Ser-62, leading to its degradation by the proteasome. In the nucleoplasm, ubiquitination is counteracted by USP28, which interacts with of FBXW7 (FBW7alpha), leading to its deubiquitination and preventing degradation. Also polyubiquitinated by the DCX(TRUSS) complex . By similarity. Involvement in disease: Note=Overexpression of C-Myc is implicated in the etiology of a variety of hematopoietic tumors. Biotechnological use: POU5F1/OCT4, SOX2, MYC/c-Myc and KLF4 are the four Yamanaka factors. When combined, these factors are sufficient to reprogram differentiated cells to an embryonic-like state designated iPS (induced pluripotent stem) cells. iPS cells exhibit the morphology and growth properties of ES cells and express ES cell marker genes. Ref.2. Sequence similarities: Contains 1 bHLH (basic helix-loop-helix) domain.
size1 :
1 mg (E-Coli)
price1 :
1920 USD
size2 :
1 mg (Yeast)
price2 :
2380
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!