product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Scytonema varium Scytovirin
catalog :
MBS1177748
quantity :
0.05 mg (Yeast)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1177748
products type :
Recombinant Protein
products full name :
Recombinant Scytonema varium Scytovirin
products short name :
Scytonema varium Scytovirin
other names :
Scytovirin; Scytovirin
other gene names :
SVN; SVN
uniprot entry name :
SVN_SCYVA
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-95, Full length.
sequence length :
95
sequence :
GSGPTYCWNEANNPGGPNRCSNNKQCDGARTCSSSGFCQ
GTSRKPDPGPKGPTYCWDEAKNPGGPNRCSNSKQCDGAR
TCSSSGFCQGTAGHAAA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Has strong anti-HIV activity against T-tropic strains of HIV-1 and weaker activity against M-tropic strains of HIV-1. Inhibits HIV-1 fusion and infection of CD4 LTR beta-gal cells in vitro. Inhibits fusion of HIV infected C-SS cells with uninfected C-SS cells, and fusion of HIV-1 Env expressing HL2/3 cells with CD4 LTR beta-gal cells. Binds to HIV gp120, HIV gp160 and to a lesser extent HIV gp41. Binding to HIV gp120 is glycosylation dependent. Binds with high specificity to the tetrasaccharide Man-alpha-1,2-Man-alpha-1,6-Man-alpha-1,6-Man and also binds the higher-order oligosaccharides oligomannose 8 and oligomannose 9. Does not bind to monosaccharides, complex or hybrid N-linked oligosaccharides or chitin.
products references :
A potent novel anti-HIV protein from the cultured cyanobacterium Scytonema varium.Bokesch H.R., O'Keefe B.R., McKee T.C., Pannell L.K., Patterson G.M.L., Gardella R.S., Sowder R.C. II, Turpin J., Watson K., Buckheit R.W. Jr., Boyd M.R.Biochemistry 42:2578-2584(2003) A potent novel anti-HIV protein from the cultured cyanobacterium Scytonema varium.Bokesch H.R., O'Keefe B.R., McKee T.C., Pannell L.K., Patterson G.M.L., Gardella R.S., Sowder R.C. II, Turpin J., Watson K., Buckheit R.W. Jr., Boyd M.R.Biochemistry 42:2578-2584(2003) . Potent anti-HIV activity of scytovirin domain 1 peptide.Xiong C., O'Keefe B.R., Byrd R.A., McMahon J.B.Peptides 27:1668-1675(2006) Overexpression and purification of scytovirin, a potent, novel anti-HIV protein from the cultured cyanobacterium Scytonema varium.Xiong C., O'Keefe B.R., Botos I., Wlodawer A., McMahon J.B.Protein Expr. Purif. 46:233-239(2006) Carbohydrate microarrays as tools in HIV glycobiology.Ratner D.M., Seeberger P.H.Curr. Pharm. Des. 13:173-183(2007) The novel fold of scytovirin reveals a new twist for antiviral entry inhibitors.McFeeters R.L., Xiong C., O'Keefe B.R., Bokesch H.R., McMahon J.B., Ratner D.M., Castelli R., Seeberger P.H., Byrd R.A.J. Mol. Biol. 369:451-461(2007) Atomic-resolution crystal structure of the antiviral lectin scytovirin.Moulaei T., Botos I., Ziolkowska N.E., Bokesch H.R., Krumpe L.R., McKee T.C., O'Keefe B.R., Dauter Z., Wlodawer A.Protein Sci. 16:2756-2760(2007)
ncbi gi num :
209573788
ncbi acc num :
P86041.1
uniprot acc num :
P86041
ncbi mol weight :
11.72kD
size1 :
0.05 mg (Yeast)
price1 :
190 USD
size2 :
0.2 mg (Yeast)
price2 :
460
size3 :
0.5 mg (Yeast)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
825
size5 :
0.5 mg (E-Coli)
price5 :
825
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!