catalog number :
MBS1177087
products type :
Recombinant Protein
products full name :
Recombinant Salmonella typhimurium Protein prgI (prgI)
products short name :
[Protein PrgI]
other names :
[secretion system protein PrgI; Protein PrgI; secretion system protein PrgI]
products gene name :
[prgI]
other gene names :
[prgI; prgI]
uniprot entry name :
PRGI_SALTY
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-80. Full length.]
sequence :
MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPS
DPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQN
FR
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-Page
other info2 :
Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
Required for invasion of epithelial cells.
products references :
PhoP/PhoQ transcriptional repression of Salmonella typhimurium invasion genes
evidence for a role in protein secretion.Pegues D.A., Hantman M.J., Behlau I., Miller S.I.Mol. Microbiol. 17:169-181(1995)
Complete genome sequence of Salmonella enterica serovar Typhimurium LT2.McClelland M., Sanderson K.E., Spieth J., Clifton S.W., Latreille P., Courtney L., Porwollik S., Ali J., Dante M., Du F., Hou S., Layman D., Leonard S., Nguyen C., Scott K., Holmes A., Grewal N., Mulvaney E., Ryan E., Sun H., Florea L., Miller W., Stoneking T., Nhan M., Waterston R., Wilson R.K.Nature 413:852-856(2001)
ncbi acc num :
NP_461794.1
ncbi gb acc num :
NC_003197.1
ncbi pathways :
Bacterial Secretion System Pathway (6542); Bacterial Secretion System Pathway (447); Type III Secretion System Pathway (606078); Type III Secretion System Pathway (890586)
uniprot summary :
Required for invasion of epithelial cells.
size6 :
0.05 mg (Baculovirus)
size9 :
0.05 mg (Mammalian-Cell)
size11 :
0.1 mg (Baculovirus)
size13 :
0.5 mg (Baculovirus)
size15 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)