product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Escherichia coli (strain K12 / DH10B) Carbon storage regulator
catalog :
MBS1176282
quantity :
0.01 mg (E-Coli)
price :
110 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1176282
products type :
Recombinant Protein
products full name :
Recombinant Escherichia coli (strain K12 / DH10B) Carbon storage regulator
products short name :
Carbon storage regulator
products name syn :
Escherichia coli (strain K12 / DH10B)
other names :
MULTISPECIES: carbon storage regulator; Carbon storage regulator; pleiotropic regulatory protein for carbon source metabolism
products gene name :
csrA
other gene names :
ESA_RS02575; csrA
uniprot entry name :
CSRA_ECODH
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
Jan-61
sequence length :
61
sequence :
MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKE
VSVHREEIYQRIQAEKSQQSSY
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Escherichia coli (strain K12 / DH10B)
products description :
Affects glycogen biosynthesis, gluconeogenesis, cell size and surface properties. Regulates glycogen synthesis under both aerobic and anaerobic conditions. Seems to accelerate the degradation of glg gene transcripts, potentially through selective RNA binding. Acts to inhibit interaction between the LetD protein and the A subunit of DNA gyrase. Also required for motility and flagellum biosynthesis through the post-transcriptional activation of flhDC expression. This involves binding to and stabilization of the flhDC message by CsrA.
products references :
The complete genome sequence of Escherichia coli DH10B: insights into the biology of a laboratory workhorse." Durfee T., Nelson R., Baldwin S., Plunkett G. III, Burland V., Mau B., Petrosino J.F., Qin X., Muzny D.M., Ayele M., Gibbs R.A., Csorgo B., Posfai G., Weinstock G.M., Blattner F.R. J. Bacteriol. 190:2597-2606(2008)
ncbi gi num :
446829230
ncbi acc num :
WP_000906486.1
ncbi gb acc num :
WP_000906486.1
uniprot acc num :
B1XCM4
ncbi mol weight :
22.85kD
ncbi pathways :
Two-component System Pathway (57804); Two-component System Pathway (437)
size1 :
0.01 mg (E-Coli)
price1 :
110 USD
size2 :
0.05 mg (E-Coli)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.5 mg (E-Coli)
price4 :
750
size5 :
0.05 mg (Baculovirus)
price5 :
785
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!