Recombinant Human Breast carcinoma-amplified sequence 1 | MyBioSource MBS1175419 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Breast carcinoma-amplified sequence 1

catalog :

MBS1175419

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1175419

products type :

Recombinant Protein

products full name :

Recombinant Human Breast carcinoma-amplified sequence 1

products short name :

Breast carcinoma-amplified sequence 1

products name syn :

Amplified and overexpressed in breast cancer; Novel amplified in breast cancer 1

other names :

breast carcinoma-amplified sequence 1 isoform 1; Breast carcinoma-amplified sequence 1; breast carcinoma-amplified sequence 1; breast carcinoma amplified sequence 1; Amplified and overexpressed in breast cancer; Novel amplified in breast cancer 1

products gene name :

BCAS1

other gene names :

BCAS1; BCAS1; AIBC1; NABC1; AIBC1; NABC1

uniprot entry name :

BCAS1_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-584

sequence length :

584

sequence :

MGNQMSVPQRVEDQENEPEAETYQDNASALNGVPVVVST
HTVQHLEEVDLGISVKTDNVATSSPETTEISAVADANGK
NLGKEAKPEAPAAKSRFFLMLSRPVPGRTGDQAADSSLG
SVKLDVSSNKAPANKDPSESWTLPVAAGPGQDTDKTPGH
APAQDKVLSAARDPTLLPPETGGAGGEAPSKPKDSSFFD
KFFKLDKGQEKVPGDSQQEAKRAEHQDKVDEVPGLSGQS
DDVPAGKDIVDGKEKEGQELG

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products references :

Positional cloning of ZNF217 and NABC1 genes amplified at 20q13.2 and overexpressed in breast carcinoma.Collins C., Rommens J.M., Kowbel D., Godfrey T., Tanner M., Hwang S.-I., Polikoff D., Nonet G., Cochran J., Myambo K., Jay K.E., Froula J., Cloutier T., Kuo W.-L., Yaswen P., Dairkee S., Giovanola J., Hutchinson G.B., Isola J., Kallioniemi O.-P., Palazzolo M., Martin C., Ericsson C., Pinkel D., Albertson D., Li W.-B., Gray J.W.Proc. Natl. Acad. Sci. U.S.A. 95:8703-8708(1998) The DNA sequence and comparative analysis of human chromosome 20.Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.Nature 414:865-871(2001) NABC1 (BCAS1) alternative splicing and downregulation in colorectal tumors.Correa R.G., de Carvalho A.F., Pinheiro N.A., Simpson A.J.G., de Souza S.J.Genomics 65:299-302(2000) The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007) Characterization of the novel amplified in breast cancer-1 (NABC1) gene product.Beardsley D.I., Kowbel D., Lataxes T.A., Mannino J.M., Xin H., Kim W.-J., Collins C., Brown K.D.Exp. Cell Res. 290:402-413(2003)

ncbi gi num :

191251777

ncbi acc num :

NP_003648.2

ncbi gb acc num :

NM_003657.2

uniprot acc num :

O75363

ncbi mol weight :

89.1kD

ncbi summary :

This gene resides in a region at 20q13 which is amplified in a variety of tumor types and associated with more aggressive tumor phenotypes. Among the genes identified from this region, it was found to be highly expressed in three amplified breast cancer cell lines and in one breast tumor without amplification at 20q13.2. However, this gene is not in the common region of maximal amplification and its expression was not detected in the breast cancer cell line MCF7, in which this region is highly amplified. Although not consistently expressed, this gene is a candidate oncogene. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2015]

uniprot summary :

BCAS1: 2 isoforms of the human protein are produced by alternative splicing. Chromosomal Location of Human Ortholog: 20q13.2. Cellular Component: cytoplasm; postsynaptic density

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (Yeast)

price5 :

750

more info or order :

MyBioSource product webpage