catalog number :
MBS1175372
products type :
Recombinant Protein
products full name :
Recombinant Mouse Protein disulfide-isomerase A2
products short name :
Disulfide-isomerase A2
other names :
protein disulfide-isomerase A2; Protein disulfide-isomerase A2; protein disulfide-isomerase A2; protein disulfide isomerase associated 2; PDIp
products gene name :
Pdia2
other gene names :
Pdia2; Pdia2; Pdip; Pdipl; AI661267; 1810041F13Rik
uniprot entry name :
PDIA2_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
21-527
sequence :
QGEEPGGPSEVLPEEPTGEEVPKEDGILVLNHRTLSLAL
QEHSALMVEFYAPWCGHCKELAPEYSKAAALLAAESAVV
TLAKVDGPAEPELTKEFEVVGYPTLKFFQNGNRTNPEEY
AGPKTAEGIAEWLRRRVGPSATHLEDEEGVQALMAKWDM
VVIGFFQDLQGKDMATFLALAKDALDMTFGFTDQPQLFE
KFGLTKDTVVLFKKFDEGRADFPVDKETGLDLGDLSRFL
VIHSMHLVTEFNSQTSPKIFA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Acts as an intracellular estrogen-binding protein. May be involved in modulating cellular levels and biological functions of estrogens in the pancreas. May act as a chaperone that inhibits aggregation of misfolded proteins.
products references :
Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009)
Molecular characterization of a pancreas-specific protein disulfide isomerase, PDIp.Desilva M.G., Notkins A.L., Lan M.S.DNA Cell Biol. 16:269-274(1997)
ncbi acc num :
NP_001074539.1
ncbi gb acc num :
NM_001081070.1
uniprot summary :
PDIA2: Acts as an intracellular estrogen-binding protein. May be involved in modulating cellular levels and biological functions of estrogens in the pancreas. May act as a chaperone that inhibits aggregation of misfolded proteins. Belongs to the protein disulfide isomerase family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: EC 5.3.4.1; Endoplasmic reticulum; Isomerase. Cellular Component: endoplasmic reticulum. Molecular Function: isomerase activity; lipid binding; peptidyl-proline 4-dioxygenase activity; protein disulfide isomerase activity; steroid binding. Biological Process: cell redox homeostasis