Recombinant Human Orexin (HCRT) | MyBioSource MBS1175207 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Orexin (HCRT)

catalog :

MBS1175207

quantity :

1 mg (E-Coli)

price :

1375 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1175207

products type :

Recombinant Protein

products full name :

Recombinant Human Orexin (HCRT)

products short name :

Orexin (HCRT)

other names :

orexin; Orexin; orexin; hypocretin (orexin) neuropeptide precursor; Hypocretin; HcrtCleaved into the following 2 chains:Orexin-A; Alternative name(s):; Hypocretin-1; Hcrt1Orexin-B; Alternative name(s):; Hypocretin-2

products gene name syn :

Recombinant Orexin (HCRT); Orexin; Hypocretin; Hcrt Cleaved into the following 2 chains: 1. Orexin-A; Hypocretin-1; Hcrt1 Orexin-B; Hypocretin-2; Hcrt2

other gene names :

HCRT; HCRT; OX; PPOX; NRCLP1; OX; PPORX; PPOX; Hcrt; Hcrt1; Hcrt2

uniprot entry name :

OREX_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence :

MHHHHHHQPLPDCCRQKTCSCRLYELLHGAGNHAAGILT
L

purity :

>90%(SDS-PAGE)

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Notes? Repeated freezing and thawing is not recommended. Store working aliquots at 4 Degree C for up to one week.

other info1 :

Species: Homo sapiens (Human)

products description :

Neuropeptides that play a significant role in the regulation of food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids, is also suggested. Orexin-A binds to both OX1R and OX2R with a high affinity, whereas orexin-B binds only to OX2R with a similar high affinity.

ncbi gi num :

4557635

ncbi acc num :

NP_001515.1

ncbi gb acc num :

NM_001524.1

uniprot acc num :

O43612

ncbi pathways :

Class A/1 (Rhodopsin-like Receptors) Pathway (106357); G Alpha (q) Signalling Events Pathway (106043); GPCR Downstream Signaling Pathway (119548); GPCR Ligand Binding Pathway (161020); Orexin And Neuropeptides FF And QRFP Bind To Their Respective Receptors Pathway (106362); Peptide Ligand-binding Receptors Pathway (106358); Signaling By GPCR Pathway (106356)

ncbi summary :

This gene encodes a hypothalamic neuropeptide precursor protein that gives rise to two mature neuropeptides, orexin A and orexin B, by proteolytic processing. Orexin A and orexin B, which bind to orphan G-protein coupled receptors HCRTR1 and HCRTR2, function in the regulation of sleep and arousal. This neuropeptide arrangement may also play a role in feeding behavior, metabolism, and homeostasis. [provided by RefSeq, Jan 2010]

uniprot summary :

HCRT: Neuropeptides that play a significant role in the regulation of food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids, is also suggested. Orexin-A binds to both OX1R and OX2R with a high affinity, whereas orexin-B binds only to OX2R with a similar high affinity. Defects in HCRT are the cause of narcolepsy type 1 (NRCLP1). Narcolepsy is a neurological disabling sleep disorder, characterized by excessive daytime sleepiness, sleep fragmentation, symptoms of abnormal rapid-eye-movement (REM) sleep, such as cataplexy, hypnagogic hallucinations, and sleep paralysis. Cataplexy is a sudden loss of muscle tone triggered by emotions, which is the most valuable clinical feature used to diagnose narcolepsy. Human narcolepsy is primarily a sporadically occurring disorder but familial clustering has been observed. Human narcolepsy is associated with a deficient orexin system. Orexins are absent and/or greatly diminished in the brain and cerebrospinal fluid (CSF) of most narcoleptic patients. Belongs to the orexin family. Protein type: Hormone. Chromosomal Location of Human Ortholog: 17q21. Cellular Component: synaptic vesicle; rough endoplasmic reticulum; perinuclear region of cytoplasm; extracellular region; cell junction; secretory granule. Molecular Function: type 2 hypocretin receptor binding; type 1 hypocretin receptor binding. Biological Process: eating behavior; negative regulation of potassium ion transport; regulation of neurotransmitter secretion; synaptic transmission; elevation of cytosolic calcium ion concentration; negative regulation of transmission of nerve impulse; negative regulation of DNA replication; neuropeptide signaling pathway; protein kinase C activation; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); regulation of excitatory postsynaptic membrane potential; positive regulation of calcium ion transport; positive regulation of transmission of nerve impulse. Disease: Narcolepsy 1

size1 :

1 mg (E-Coli)

price1 :

1375 USD

size2 :

1 mg (Yeast)

price2 :

1835

more info or order :

MyBioSource product webpage