catalog number :
MBS1174702
products type :
Recombinant Protein
products full name :
Recombinant Haemophilus influenzae Biopolymer transport protein exbB (exbB)
products short name :
Biopolymer transport protein exbB (exbB)
products name syn :
Recombinant Biopolymer transport protein exbB (exbB); Biopolymer transport protein exbB
other names :
transport protein ExbB; Biopolymer transport protein ExbB; transport protein ExbB
products gene name syn :
exbB
other gene names :
exbB; exbB
uniprot entry name :
EXBB_HAEIN
sequence positions :
1-150
sequence :
MVQLFDFLQQYSDYFIIGLLLLMSIIMLAMVIERYLFLR
KVSVAHYSTIHALDIDLNRNMTVISTIGANAPYVGLLGT
VIGILLTFYQIGHGGGDIDPSVIMLHLSLALKATALGIL
VAIPSMVFYNGLGRKVEVNRLKWKVLSEQKDKE
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi acc num :
NP_438422.1
ncbi gb acc num :
NC_000907.1
ncbi mol weight :
16,729 Da
uniprot summary :
Function: Involved in the TonB-dependent energy-dependent transport of various receptor-bound substrates. Protects ExbD from proteolytic degradation and functionally stabilizes TonB . By similarity. Subunit structure: The accessory proteins ExbB and ExbD seem to form a complex with TonB . By similarity. Subcellular location: Cell inner membrane; Multi-pass membrane protein. Sequence similarities: Belongs to the ExbB/TolQ family.
size :
1 mg (E Coli Derived)