catalog number : 
MBS1174702
products type : 
Recombinant Protein
products full name : 
Recombinant Haemophilus influenzae Biopolymer transport protein exbB (exbB)
products short name : 
Biopolymer transport protein exbB (exbB)
products name syn : 
Recombinant Biopolymer transport protein exbB (exbB); Biopolymer transport protein exbB
other names : 
transport protein ExbB; Biopolymer transport protein ExbB; transport protein ExbB
products gene name syn : 
exbB
other gene names : 
exbB; exbB
uniprot entry name : 
EXBB_HAEIN
sequence positions : 
1-150
sequence : 
MVQLFDFLQQYSDYFIIGLLLLMSIIMLAMVIERYLFLR
KVSVAHYSTIHALDIDLNRNMTVISTIGANAPYVGLLGT
VIGILLTFYQIGHGGGDIDPSVIMLHLSLALKATALGIL
VAIPSMVFYNGLGRKVEVNRLKWKVLSEQKDKE
form : 
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability : 
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 : 
Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information).  Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
other info2 : 
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi acc num : 
NP_438422.1
ncbi gb acc num : 
NC_000907.1
ncbi mol weight : 
16,729 Da
uniprot summary : 
Function: Involved in the TonB-dependent energy-dependent transport of various receptor-bound substrates. Protects ExbD from proteolytic degradation and functionally stabilizes TonB  .  By similarity.  Subunit structure: The accessory proteins ExbB and ExbD seem to form a complex with TonB  .  By similarity.  Subcellular location: Cell inner membrane; Multi-pass membrane protein.  Sequence similarities: Belongs to the ExbB/TolQ family.
size : 
1 mg (E Coli Derived)