product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Troponin I, cardiac muscle (Tnni3)
catalog :
MBS1173692
quantity :
0.01 mg (E-Coli)
price :
200 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1173692
products type :
Recombinant Protein
products full name :
Recombinant Mouse Troponin I, cardiac muscle (Tnni3)
products short name :
[Troponin I, cardiac muscle (Tnni3)]
products name syn :
[Troponin I, cardiac muscle; Cardiac troponin I]
other names :
[troponin I, cardiac muscle; Troponin I, cardiac muscle; troponin I, cardiac muscle; cardiac troponin I; troponin I, cardiac 3; Cardiac troponin I]
products gene name :
[Tnni3]
other gene names :
[Tnni3; Tnni3; Tn1; cTnI]
uniprot entry name :
TNNI3_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[2-211aa; Full Length of Mature Protein]
sequence length :
211
sequence :
ADESSDAAGEPQPAPAPVRRRSSANYRAYATEPHAKKKS
KISASRKLQLKTLMLQIAKQEMEREAEERRGEKGRVLRT
RCQPLELDGLGFEELQDLCRQLHARVDKVDEERYDVEAK
VTKNITEIADLTQKIYDLRGKFKRPTLRRVRISADAMMQ
ALLGTRAKESLDLRAHLKQVKKEDIEKENREVGDWRKNI
DALSGMEGRKKKFEG
purity :
>=90%
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-Page
other info1 :
Species: Mus musculus (Mouse)
other info2 :
Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products categories :
Signal Transduction
products description :
Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
ncbi gi num :
6678393
ncbi acc num :
NP_033432.1
ncbi gb acc num :
NM_009406.3
uniprot acc num :
P48787
ncbi mol weight :
24,259 Da
ncbi pathways :
Adrenergic Signaling In Cardiomyocytes Pathway (908268); Adrenergic Signaling In Cardiomyocytes Pathway (909696); Cardiac Muscle Contraction Pathway (93345); Cardiac Muscle Contraction Pathway (93992); Dilated Cardiomyopathy Pathway (121495); Dilated Cardiomyopathy Pathway (121285); Hypertrophic Cardiomyopathy (HCM) Pathway (114298); Hypertrophic Cardiomyopathy (HCM) Pathway (106591); Muscle Contraction Pathway (927058); Striated Muscle Contraction Pathway (927059)
uniprot summary :
TNNI3: Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity. Binds to actin and tropomyosin. Interacts with TRIM63. Interacts with STK4/MST1. Belongs to the troponin I family. Protein type: Motility/polarity/chemotaxis; Actin-binding; Motor. Cellular Component: sarcomere; troponin complex; myofibril; contractile fiber; cell; cytoplasm. Molecular Function: troponin T binding; troponin C binding; protein domain specific binding; metal ion binding; calcium channel inhibitor activity; actin binding; protein kinase binding; calcium-dependent protein binding. Biological Process: regulation of smooth muscle contraction; cellular calcium ion homeostasis; striated muscle contraction; heart contraction; regulation of muscle contraction; heart development; regulation of systemic arterial blood pressure by ischemic conditions; ventricular cardiac muscle morphogenesis; vasculogenesis; negative regulation of ATPase activity; cardiac muscle contraction
size1 :
0.01 mg (E-Coli)
price1 :
200 USD
size2 :
0.05 mg (E-Coli)
price2 :
260
size3 :
0.1 mg (E-Coli)
price3 :
430
size4 :
0.2 mg (E-Coli)
price4 :
685
size5 :
0.5 mg (E-Coli)
price5 :
1125
size6 :
1 mg (E-Coli)
price6 :
1725
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!