catalog number :
MBS1172365
products type :
Recombinant Protein
products full name :
Recombinant Mycoplasma pneumoniae ADP-ribosylating toxin CARDS (MPN_372), partial
products short name :
[ADP-ribosylating toxin CARDS (MPN_372)]
other names :
[ADP-ribosylating toxin; ADP-ribosylating toxin CARDS; ADP-ribosylating toxin; ADP-ribosyltransferase CARDS; CARDX TX]
products gene name :
[MPN_372]
other gene names :
[MPN372; MPN_372; A19_orf591]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-202. Partial]
sequence :
MPNPVRFVYRVDLRSPEEIFEHGFSTLGDVRNFFEHILS
TNFGRSYFISTSETPTAAIRFFGSWLREYVPEHPRRAYL
YEIRADQHFYNARATGENLLDLMRQRQVVFDSGDREMAQ
MGIRALRTSFAYQREWFTDGPIAAANVRSAWLVDAVPVE
PGHAHHPAGRVVETTRINEPEMHNPHYQELQTQANDQPW
LPTPGIA
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Mycoplasma pneumoniae (strain ATCC 29342 / M129)
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol. Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
ncbi acc num :
NP_110060.1
ncbi gb acc num :
NC_000912.1
ncbi mol weight :
68,057 Da
uniprot summary :
Acts as an ADP-ribosylating toxin, which may transfer the ADP-ribosyl group from NAD+ to specific amino acids in target proteins. Elicits cytopathic effects in mammalian cells, such as disorganization and disruption of respiratory epithelial integrity in tracheal epithelium and vacuolization in the cytoplasm of CHO and HeLa cells.
size6 :
0.05 mg (Baculovirus)
size10 :
0.05 mg (Mammalian-Cell)
size11 :
0.1 mg (Baculovirus)
size14 :
0.5 mg (Baculovirus)
size15 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)