product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Transcription cofactor vestigial-like protein 3
catalog :
MBS1170312
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1170312
products type :
Recombinant Protein
products full name :
Recombinant Human Transcription cofactor vestigial-like protein 3
products short name :
Transcription cofactor vestigial-like protein 3
other names :
transcription cofactor vestigial-like protein 3; Transcription cofactor vestigial-like protein 3; transcription cofactor vestigial-like protein 3; vestigial like family member 3
products gene name :
VGLL3
other gene names :
VGLL3; VGLL3; VGL3; VGL-3; Vgl-3
uniprot entry name :
VGLL3_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-320
sequence length :
326
sequence :
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQP
GQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQP
AEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLH
PESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQ
PPPAPCLGGVHPDFQVTGPPGTFSAADPSPWPGHNLHQT
GPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHA
HMHHRHRHHHHHHHPPAGSAL
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Transcription
products description :
May act as a specific coactivator for the mammalian TEFs.
products references :
The DNA sequence, annotation and analysis of human chromosome 3.Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.Nature 440:1194-1198(2006)
ncbi gi num :
56550035
ncbi acc num :
NP_057290.2
ncbi gb acc num :
NM_016206.2
uniprot acc num :
A8MV65
ncbi mol weight :
37.1kD
uniprot summary :
VGLL3: May act as a specific coactivator for the mammalian TEFs. Belongs to the vestigial family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Transcription, coactivator/corepressor. Chromosomal Location of Human Ortholog: 3p12.1. Cellular Component: nucleus. Molecular Function: protein C-terminus binding. Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
950
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1170
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!