product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Suppressor of cytokine signaling 3
catalog :
MBS1169806
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1169806
products type :
Recombinant Protein
products full name :
Recombinant Rat Suppressor of cytokine signaling 3
products short name :
Suppressor of cytokine signaling 3
products name syn :
Cytokine-inducible SH2 protein 3
other names :
suppressor of cytokine signaling 3; Suppressor of cytokine signaling 3; suppressor of cytokine signaling 3; suppressor of cytokine signaling 3; Cytokine-inducible SH2 protein 3
products gene name :
Socs3
other gene names :
Socs3; Socs3; Cish3; Ssi-3; Socs-3; Cish3; SOCS-3
uniprot entry name :
SOCS3_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-225
sequence length :
225
sequence :
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVR
KLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRH
FFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRF
DCVLKLVHHYMPPPGAPSFSLPPTEPSFEVQEQPPAQAL
PGGTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRK
TVNGHLDSYEKVTQLPGPIREFLDQYDAPL
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including gp130, LIF, erythropoietin, insulin, IL12, GCSF and leptin receptors. Binding to JAK2 inhibits its kinase activity. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Regulates IL-6 signaling in vivo. Probable substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Ses to recognize IL6ST.
products references :
Endotoxin-induced inhibition of growth hormone receptor signaling in rat liver in vivo.Mao Y., Ling P.R., Fitzgibbons T.P., McCowen K.C., Frick G.P., Bistrian B.R., Smith R.J.Endocrinology 140:5505-5515(1999) le Cam A. Identification of the Y985 and Y1077 motifs as SOCS3 recruitment sites in the murine leptin receptor.Eyckerman S., Broekaert D., Verhee A., Vandekerckhove J., Tavernier J.FEBS Lett. 486:33-37(2000)
ncbi gi num :
16758336
ncbi acc num :
NP_446017.1
ncbi gb acc num :
NM_053565.1
uniprot acc num :
O88583
ncbi mol weight :
40.79kD
ncbi pathways :
Adaptive Immune System Pathway (1332755); Adipocytokine Signaling Pathway (83485); Adipocytokine Signaling Pathway (505); Adipogenesis Pathway (198479); Antigen Processing: Ubiquitination Proteasome Degradation Pathway (1332778); Class I MHC Mediated Antigen Processing Presentation Pathway (1332777); Cytokine Signaling In Immune System Pathway (1332884); ECS Complex Pathway (434769); ECS Complex Pathway (468394); EGFR1 Signaling Pathway (198427)
ncbi summary :
regulates cytokine levels to modulate inflammation [RGD, Feb 2006]
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!