product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Serotonin N-acetyltransferase (AANAT)
catalog :
MBS1168637
quantity :
1 mg (E-Coli)
price :
1385 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1168637
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Serotonin N-acetyltransferase (AANAT)
products short name :
(Rhesus macaque) Serotonin N-acetyltransferase (AANAT)
other names :
serotonin N-acetyltransferase; Serotonin N-acetyltransferase; serotonin N-acetyltransferase; AA-NAT; serotonin acetylase; arylalkylamine N-acetyltransferase; pineal arylalkylamine N-acetyltransferase; Aralkylamine N-acetyltransferase
products gene name syn :
Recombinant (Rhesus macaque) Serotonin N-acetyltransferase (AANAT); Serotonin N-acetyltransferase; Serotonin acetylase EC= 2.3.1.87; Aralkylamine N-acetyltransferase; AA-NAT
other gene names :
AANAT; AANAT; SNAT; Serotonin acetylase; AA-NAT
uniprot entry name :
SNAT_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-204
sequence length :
204
sequence :
MSTQSTHPPKPEAPRLPPAISSCQRRHTLPASEFRCLTP
EDAVSAFEIEREAFISVLGVCPLYLDEIRHFLTLCPELS
LGWFEEGCLVAFIIGSLWDKDRLMQESLTMHRPGGHIAH
LHVLAVHCAFRQQGRGPILLWRYLHHLGSQPAVHRAALM
CEDALVPFYERFGFHAMGPCAITVGSLSFTELHCSLQGH
PFLRRNSGC
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
products description :
AANAT; SNAT
ncbi gi num :
114051942
ncbi acc num :
NP_001040592.1
ncbi gb acc num :
NM_001047127.1
uniprot acc num :
O97756
ncbi mol weight :
22,891 Da
ncbi pathways :
Melatonin Biosynthesis, Tryptophan = Serotonin = Melatonin Pathway (419263); Melatonin Biosynthesis, Tryptophan = Serotonin = Melatonin Pathway (468230); Tryptophan Metabolism Pathway (86635); Tryptophan Metabolism Pathway (332)
uniprot summary :
Function: Controls the night/day rhythm of melatonin production in the pineal gland. Catalyzes the N-acetylation of serotonin into N-acetylserotonin, the penultimate step in the synthesis of melatonin. Ref.1. Catalytic activity: Acetyl-CoA + a 2-arylethylamine = CoA + an N-acetyl-2-arylethylamine. Pathway: Aromatic compound metabolism; melatonin biosynthesis; melatonin from serotonin: step 1/2. Subunit structure: Monomer . By similarity. Interacts with several 14-3-3 proteins, including YWHAB, YWHAE, YWHAG and YWHAZ, preferentially when phosphorylated at Thr-28 . By similarity. Phosphorylation on Ser-202 also allows binding to YWHAZ, but with lower affinity . By similarity. The interaction with YWHAZ considerably increases affinity for arylalkylamines and acetyl-CoA and protects the enzyme from dephosphorylation and proteasomal degradation. It may also prevent thiol-dependent inactivation . By similarity. Subcellular location: Cytoplasm . By similarity. Tissue specificity: Highly expressed in pineal gland and in the photoreceptor outer segments in the retina. Expressed at about 100-fold lower levels in the pituitary gland and testis. Not detected in other tissues. Ref.1. Induction: Exhibits night/day variations with a 10-fold increased protein levels and activity at night in the pineal gland and a 5-fold increase in the retina. In both tissues, the mRNA levels remain constant. Ref.1. Post-translational modification: cAMP-dependent phosphorylation regulates AANAT activity by promoting interaction with 14-3-3 proteins. Phosphorylation levels exhibit night/day variations, with an increase during nighttime. Sequence similarities: Belongs to the acetyltransferase family. AANAT subfamily.Contains 1 N-acetyltransferase domain.
size1 :
1 mg (E-Coli)
price1 :
1385 USD
size2 :
1 mg (Yeast)
price2 :
1845
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!