product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Perfringolysin O (pfo)
catalog :
MBS1166985
quantity :
0.05 mg (E-Coli)
price :
180 USD
more info or order :
product information
catalog number :
MBS1166985
products type :
Recombinant Protein
products full name :
Recombinant Perfringolysin O (pfo)
products short name :
Perfringolysin O (pfo)
products name syn :
Perfringolysin O; Theta-toxin; Thiol-activated cytolysin
other names :
perfringolysin O; Perfringolysin O; perfringolysin O; Theta-toxin; Thiol-activated cytolysin
products gene name :
pfo
products gene name syn :
pfo; pfoA; pfoR; CPE0163
other gene names :
pfoA; pfo; pfoA; pfoR
uniprot entry name :
TACY_CLOPE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
29-500; Mature full length protein
sequence length :
500
sequence :
KDITDKNQSIDSGISSLSYNRNEVLASNGDKIESFVPKE
GKKTGNKFIVVERQKRSLTTSPVDISIIDSVNDRTYPGA
LQLADKAFVENRPTILMVKRKPININIDLPGLKGENSIK
VDDPTYGKVSGAIDELVSKWNEKYSSTHTLPARTQYSES
MVYSKSQISSALNVNAKVLENSLGVDFNAVANNEKKVMI
LAYKQIFYTVSADLPKNPSDLFDDSVTFNDLKQKGVSNE
APPLMVSNVAYGRTIYVKLETTSSSKDVQAAFKALIKNT
DIKNSQQYKDIYENSSFTAVVLGGDAQEHNKVVTKDFDE
IRKVIKDNATFSTKNPAYPISYTSVFLKDNSVAAVHNKT
DYIETTSTEYSKGKINLDHSGAYVAQFEVAWDEVSYDKE
GNEVLTHKTWDGNYQDKTAHYSTVIPLEANARNIRIKAR
ECTGLAWEWWRDVISEYDVPLTNNINVSIWGTTLYPGSS
ITYN
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Clostridium perfringens
ncbi gi num :
18309145
ncbi acc num :
NP_561079.1
ncbi gb acc num :
NC_003366.1
uniprot acc num :
P0C2E9
ncbi mol weight :
55,830 Da
size1 :
0.05 mg (E-Coli)
price1 :
180 USD
size2 :
0.2 mg (E-Coli)
price2 :
490
size3 :
0.5 mg (E-Coli)
price3 :
715
size4 :
0.05 mg (Baculovirus)
price4 :
950
size5 :
1 mg (E-Coli)
price5 :
1170
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!