product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Phospholipase A2, membrane associated
catalog :
MBS1158822
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1158822
products type :
Recombinant Protein
products full name :
Recombinant Rat Phospholipase A2, membrane associated
products short name :
Phospholipase A2, membrane associated
products name syn :
GIIC sPLA2; Group IIA phospholipase A2; Phosphatidylcholine 2-acylhydrolase 2A
other names :
phospholipase A2, membrane associated; Phospholipase A2, membrane associated; phospholipase A2, membrane associated; phospholipase A2 group IIA; GIIC sPLA2; Group IIA phospholipase A2; Phosphatidylcholine 2-acylhydrolase 2A
products gene name :
Pla2g2a
other gene names :
Pla2g2a; Pla2g2a; sPLA2
uniprot entry name :
PA2GA_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
22-146
sequence length :
146
sequence :
SLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDA
TDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCS
TNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKF
CKGKTPSC
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Thought to participate in the regulation of the phospholipid metabolism in biomembranes including eicosanoid biosynthesis. Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.
products references :
Structure of cDNA coding for rat platelet phospholipase A2.Komada M., Kudo I., Mizushima H., Kitamura N., Inoue K.J. Biochem. 106:545-547(1989) Structure of gene coding for rat group II phospholipase A2.Komada M., Kudo I., Inoue K.Biochem. Biophys. Res. Commun. 168:1059-1065(1990) cDNA cloning and sequence determination of rat membrane-associated phospholipase A2.Ishizaki J., Ohara O., Nakamura E., Tamaki M., Ono T., Kanda A., Yoshida N., Teraoka H., Tojo H., Okamoto M.Biochem. Biophys. Res. Commun. 162:1030-1036(1989) Structure of genomic DNA for rat platelet phospholipase A2.Kusunoki C., Satoh S., Kobayashi M., Niwa M.Biochim. Biophys. Acta 1087:95-97(1990) The primary structure of rat platelet phospholipase A2.Hayakawa M., Kudo I., Tomita M., Nojima S., Inoue K.J. Biochem. 104:767-772(1988) Purification and characterization of a membrane-associated phospholipase A2 from rat spleen. Its comparison with a cytosolic phospholipase A2 S-1.Ono T., Tojo H., Kuramitsu S., Kagamiyama H., Okamoto M.J. Biol. Chem. 263:5732-5738(1988) Amino acid composition and NH2-terminal amino acid sequence of rat platelet secretory phospholipase A2.Hayakawa M., Horigome K., Kudo I., Tomita M., Nojima S., Inoue K.J. Biochem. 101:1311-1314(1987) Immunoaffinity purification, partial sequence, and subcellular localization of rat liver phospholipase A2.Aarsman A.J., de Jong J.G.N., Arnoldussen E., Neys F.W., van Wassenaar P.D., van den Bosch H.J. Biol. Chem. 264:10008-10014(1989)
ncbi gi num :
291621686
ncbi acc num :
NP_113786.3
ncbi gb acc num :
NM_031598.3
uniprot acc num :
P14423
ncbi mol weight :
30.1kD
ncbi pathways :
Acyl Chain Remodelling Of PC Pathway (1333371); Acyl Chain Remodelling Of PE Pathway (1333367); Acyl Chain Remodelling Of PG Pathway (1333378); Acyl Chain Remodelling Of PI Pathway (1333376); Acyl Chain Remodelling Of PS Pathway (1333374); Arachidonic Acid Metabolism Pathway (83383); Arachidonic Acid Metabolism Pathway (366); Eicosanoid Synthesis Pathway (198497); Ether Lipid Metabolism Pathway (83382); Ether Lipid Metabolism Pathway (365)
ncbi summary :
hydrolyzes acyl group at the sn-2 position of phospholipids, forming non-esterified fatty acids and lysophospholipids; plays a critical role in inflammation; induces proliferation of smooth muscle cells [RGD, Feb 2006]
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!