PSFSQQQPPFWQQQPPFSQQQPILPQQPPFSQQQQLVLP
QQPPFSQQQQPVLPPQQSPFPQQQQQHQQLVQQQIPVVQ
PSILQQLNPCKVFLQQQCSPVAMPQRLARSQMLQQSSCH
VMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQG
SIQSQQQQPQQLGQCVSQPQQQSQQQLGQQPQQQQLAQG
TFLQPHQIAQLEVMTSIALRILPTMCSVNVPLYRTTTSV
PFGVGTGVGAY

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Rat Phospholipase A2, membrane associated | MBS1158822
- Recombinant Streptomyces lividans DNA-binding protein HU 1 | MBS1158865
- Recombinant Centruroides noxius Beta-mammal toxin Cn2 | MBS1160510
- Recombinant Triticum monococcum (Einkorn wheat) Omega-gliadin | MBS1160722
- Recombinant Human Multidrug resistance-associated protein 1 (ABCC1), partial