catalog number :
MBS1156421
products type :
Recombinant Protein
products full name :
Recombinant Chlamydia trachomatis 60 kDa chaperonin (groL), partial
products short name :
[60 kDa chaperonin (groL), partial]
products name syn :
[60 kDa chaperonin; 57 kDa chlamydial hypersensitivity antigen; GroEL protein; Heat shock protein 60; HSP60; Protein Cpn60]
other names :
[chaperonin GroEL; 60 kDa chaperonin; chaperonin GroEL; 57 kDa chlamydial hypersensitivity antigenGroEL protein; Heat shock protein 60]
products gene name :
[groL]
products gene name syn :
[groL; groEL; hypB; mopA; CT_110]
other gene names :
[groEL_1; groL; HSP60]
uniprot entry name :
CH60_CHLTR
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[2-544. Full Length of Mature Protein]
sequence :
VAKNIKYNEEARKKIQKGVKTLAEAVKVTLGPKGRHVVI
DKSFGSPQVTKDGVTVAKEVELADKHENMGAQMVKEVAS
KTADKAGDGTTTATVLAEAIYTEGLRNVTAGANPMDLKR
GIDKAVKVVVDQIRKISKPVQHHKEIAQVATISANNDAE
IGNLIAEAMEKVGKNGSITVEEAKGFETVLDIVEGMNFN
RGYLSSYFATNPETQECVLEDALVLIYDKKISGIKDFLP
VLQQVAESGRPLLIIAEDIEGEALATLVVNRIRGGFRVC
AVKAPGFGDRRKAMLEDIAILTGGQLISEELGMKLENAN
LAMLGKAKKVIVSKEDTTIVEGMGEKEALEARCESIKKQ
IEDSSSDYDKEKLQERLAKLSGGVAVIRVGAATEIEMKE
KKDRVDDAQHATIAAVEEGILPGGGTALIRCIPTLEAFL
PMLTNEDEQIGARIVLKALSAPLKQIAANAGKEGAIIFQ
QVMSRSANEGYDALRDAYTDMLEAGILDPAKVTRSALES
AASVAGLLLTTEALIAEIPEEKPAAAPAMPGAGMDY
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-PAGE
other info1 :
Species: Chlamydia trachomatis (strain D/UW-3/Cx)
other info2 :
Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products categories :
Microbiology
products description :
Prevents misfolding and promotes the refolding and proper assembly of unfolded polypeptides generated under stress conditions (By similarity). This protein is implicated in the pathogenesis of chlamydial disease. Inflammation elicited by the 57 kDa antigen may damage tissue, with progression to scarring of conjunctival and fallopian tube mucosae, which respectively result in blindness and infertility.
ncbi acc num :
NP_219613.1
ncbi gb acc num :
NC_000117.1
ncbi mol weight :
58,147 Da
ncbi pathways :
RNA Degradation Pathway (116138); RNA Degradation Pathway (116127)
uniprot summary :
Prevents misfolding and promotes the refolding and proper assembly of unfolded polypeptides generated under stress conditions (). This protein is implicated in the pathogenesis of chlamydial disease. Inflammation elicited by the 57 kDa antigen may damage tissue, with progression to scarring of conjunctival and fallopian tube mucosae, which respectively result in blindness and infertility.
size7 :
0.05 mg (Baculovirus)
size9 :
0.05 mg (Mammalian-Cell)
size12 :
0.1 mg (Baculovirus)
size13 :
0.5 mg (Baculovirus)
size14 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)