
RSGSSRQSIQKYIKNNYTVGENADSQIKLSIKRLVTSGT
LKQTKGVGASGSFRLAKADEVKKPAKKPKKEIKKAVSPK
KAAKPKKAAKSPAKAKKPKVAEKKVKKAPKKKPAPSPRK
AKKTKTVRAKPVWASKAKKAKPSKPKAKASPKKSGRKK

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Chlamydia trachomatis 60 kDa chaperonin (groL), partial | MBS1156421
- Recombinant Rickettsia rickettsii 17 kDa surface antigen (omp) | MBS1167141
- Recombinant Mycoplasma pneumoniae ADP-ribosylating toxin CARDS (MPN_372), partia ...
- Recombinant Mouse Troponin I, cardiac muscle (Tnni3) | MBS1173692
- Recombinant Salmonella typhimurium Protein prgI (prgI) | MBS1177087