catalog number :
MBS1155141
products type :
Recombinant Protein
products full name :
Recombinant Human papillomavirus type 16 Regulatory protein E2
products short name :
papillomavirus type 16 Regulatory protein E2
other names :
regulatory protein; Regulatory protein E2; regulatory protein
other gene names :
E2; E2
uniprot entry name :
VE2_HPV16
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-365
sequence :
METLCQRLNVCQDKILTHYENDSTDLRDHIDYWKHMRLE
CAIYYKAREMGFKHINHQVVPTLAVSKNKALQAIELQLT
LETIYNSQYSNEKWTLQDVSLEVYLTAPTGCIKKHGYTV
EVQFDGDICNTMHYTNWTHIYICEEASVTVVEGQVDYYG
LYYVHEGIRTYFVQFKDDAEKYSKNKVWEVHAGGQVILC
PTSVFSSNEVSSPEIIRQHLANHPAATHTKAVALGTEET
QTTIQRPRSEPDTGNPCHTTK
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Epigenetics and Nuclear Signaling
products description :
Plays an accessory role in initiation of DNA replication. A dimer of E2 interacts with a dimer of E1 in order to improve specificity of E1 DNA binding activity. Once the complex recognizes and binds DNA at specific sites, the E2 dimer is roved from DNA. E2 also regulates viral transcription through binding to the E2RE response element (5'-ACCNNNNNNGGT-3') present in multiple copies in the regulatory regions of the viral genome. Activates or represses transcription depending on E2RE's position with regards to proximal promoter elements including the TATA-box. Repression occurs by sterically hindering the assembly of the transcription initiation complex.
products references :
Human papillomavirus type 16 DNA sequence.Seedorf K., Krammer G., Durst M., Suhai S., Rowekamp W.G.Virology 145:181-185(1985)
Cloning and sequencing of non-European human papillomavirus (HPV)variant complete genomes from cervicovaginal cells by an overlapping PCR method.Terai M., Fu L., Ma Z., Burk R.D. Transcriptional trans-activation by the human papillomavirus type 16 E2 gene product.Phelps W.C., Howley P.M.J. Virol. 61:1630-1638(1987)
Transient replication of human papillomavirus DNAs.Del Vecchio A.M., Romanczuk H., Howley P.M., Baker C.C.J. Virol. 66:5949-5958(1992)
Human papillomavirus 16 L2 inhibits the transcriptional activation function, but not the DNA replication function, of HPV-16 E2.Okoye A., Cordano P., Taylor E.R., Morgan I.M., Everett R., Campo M.S.Virus Res. 108:1-14(2005)
Regulation of human papillomavirus type 16 E7 activity through direct protein interaction with the E2 transcriptional activator.Gammoh N., Grm H.S., Massimi P., Banks L.J. Virol. 80:1787-1797(2006)
TAF1 interacts with and modulates human papillomavirus 16 E2-dependent transcriptional regulation.Centeno F., Ramirez-Salazar E., Garcia-Villa E., Gariglio P., Garrido E.Intervirology 51:137-143(2008)
Expression, crystallization and preliminary X-ray analysis of the E2 transactivation domain from papillomavirus type 16.Burns J.E., Moroz O.V., Antson A.A., Sanders C.M., Wilson K.S., Maitland N.J.Acta Crystallogr. D 54:1471-1474(1998)
ncbi acc num :
NP_041328.1
ncbi gb acc num :
NC_001526.2
size4 :
0.05 mg (Baculovirus)