product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Type II iodothyronine deiodinase
catalog :
MBS1153190
quantity :
INQUIRE
price :
INQUIRE
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1153190
products type :
Recombinant Protein
products full name :
Recombinant Rat Type II iodothyronine deiodinase
products short name :
Type II iodothyronine deiodinase
products name syn :
5DII DIOII Type 2 DI Type-II 5'-deiodinase
other names :
type II iodothyronine deiodinase; Type II iodothyronine deiodinase; type II iodothyronine deiodinase; deiodinase, iodothyronine, type II; 5DII; DIOII; Type 2 DI; Type-II 5'-deiodinase
products gene name :
Dio2
other gene names :
Dio2; Dio2; 5DII; DIOII; Itdi2; Txdi2
uniprot entry name :
IOD2_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-266
sequence length :
266
sequence :
MGLLSVDLLITLQILPVFFSNCLFLALYDSVILLKHVAL
LLSRSKSTRGEWRRMLTSEGLRCVWNSFLLDAYKQVKLG
EDAPNSSVVHVSNPEAGNNCASEKTADGAECHLLDFASA
ERPLVVNFGSATUPPFTRQLPAFRQLVEEFSSVADFLLV
YIDEAHPSDGWAVPGDSSMSFEVKKHRNQEDRCAAAHQL
LERFSLPPQCQVVADRMDNNANVAYGVAFERVCIVQRRK
IAYLGGKGPFSYNLQEVRSWL
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Catalyzes the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into T3 (3,5,3'-triiodothyronine). Essential for providing the brain with appropriate levels of T3 during the critical period of development.
products references :
Cloning of the mammalian type II iodothyronine deiodinase. A selenoprotein differentially expressed and regulated in human and rat brain and other tissues.Croteau W., Davey J.C., Galton V.A., St Germain D.L.J. Clin. Invest. 98:405-417(1996) Induction of type 2 deiodinase activity by cyclic guanosine 3',5'-monophosphate in cultured rat glial cells.Gondou A., Toyoda N., Nishikawa M., Tabata S., Yonemoto T., Ogawa Y., Tokoro T., Sakaguchi N., Wang F., Inada M.Thyroid 8:615-622(1998) Expression and nocturnal increase of type II iodothyronine deiodinase mRNA in rat pineal gland.Murakami M., Hosoi Y., Negishi T., Kamiya Y., Ogiwara T., Mizuma H., Yamada M., Iriuchijima T., Mori M.Neurosci. Lett. 227:65-67(1997) Night/day changes in pineal expression of >600 genes central role of adrenergic/cAMP signaling.Bailey M.J., Coon S.L., Carter D.A., Humphries A., Kim J.S., Shi Q., Gaildrat P., Morin F., Ganguly S., Hogenesch J.B., Weller J.L., Rath M.F., Moller M., Baler R., Sugden D., Rangel Z.G., Munson P.J., Klein D.C.J. Biol. Chem. 284:7606-7622(2009)
ncbi gi num :
132566529
ncbi acc num :
NP_113908.3
ncbi gb acc num :
NM_031720.3
uniprot acc num :
P70551
ncbi mol weight :
61.5kD
ncbi pathways :
Selenium Metabolism Selenoproteins Pathway (219789); Thyroid Hormone Signaling Pathway (946618)
ncbi summary :
The protein encoded by this gene belongs to the iodothyronine deiodinase family. It activates thyroid hormone by converting the prohormone thyroxine (T4) by outer ring deiodination (ORD) to bioactive 3,3',5-triiodothyronine (T3). The expression of this gene in some tissues is regulated by the level of thyroid hormone. This protein contains selenocysteine (Sec) residues encoded by the UGA codon, which normally signals translation termination. The 3' UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. [provided by RefSeq, Jul 2008]
size1 :
INQUIRE
price1 :
INQUIRE
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!