protein

Recombinant Human respiratory syncytial virus B Major surface glycoprotein G (G)

MBS1149971

1 mg (E-Coli)

1375 USD

Recombinant Protein

Recombinant Human respiratory syncytial virus B Major surface glycoprotein G (G)

Major surface glycoprotein G (G)

Recombinant Major surface glycoprotein G (G); Major surface glycoprotein G; Attachment glycoprotein G Membrane-bound glycoprotein; mG

Major surface glycoprotein G; Major surface glycoprotein G; Attachment glycoprotein G; Membrane-bound glycoprotein

G; mG

GLYC_HRSV1

E Coli or Yeast or Baculovirus or Mammalian Cell

1-292

292

MSKHKNQRTARTLEKTWDTLNHLIVISSCLYRLNLKSIA
QIALSVLAMIISTSLIIAAIIFIISANHKVTLTTVTVQT
IKNHTEKNISTYLTQVPPERVNSSKQPTTTSPIHTNSAT
ISPNTKSETHHTTAQTKGRITTSTQTNKPSTKSRSKNPP
KKPKDDYHFEVFNFVPCSICGNNQLCKSICKTIPSNKPK
KKPTIKPTNKPTTKTTNKRDPKTPAKMPKKEIITNPAKK
PTLKTTERDTSISQSTVLDTITPKYTIQQQSLHSTTSEN
TPSSTQIPTASEPSTLNPN

>90%(SDS-PAGE)

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Species: Human respiratory syncytial virus B (strain 18537)

Attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Interacts with host CX3CR1, the receptor for the CX3C chemokine fractalkine, to modulate the immune response and facilitate infection. Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hemagglutinating activities.Secreted glycoprotein G helps RSV escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fcgamma receptors.

138286

P20896.1

P20896

34kD

Focal Adhesion Pathway (83067); Focal Adhesion Pathway (478); MAPK Signaling Pathway (83048); MAPK Signaling Pathway (456); Salmonella Infection Pathway (375172); Salmonella Infection Pathway (375149)

Function: Attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Interacts with host CX3CR1, the receptor for the CX3C chemokine fractalkine, to modulate the immune response and facilitate infection. Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hemagglutinating activities . By similarity.Secreted glycoprotein G helps RSV escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fcgamma receptors . By similarity. Subunit structure: Homooligomer. Interacts (via N-terminus) with protein M. Interacts with protein F; this interaction occurs on the surface of infected cells. Interacts with protein SH. Interacts with host CX3CR1; this interaction modulates host immune response . By similarity. Subcellular location: Virion membrane. Host cell surface . By similarity. Isoform Secreted glycoprotein G: Secreted. Domain: Contains a linear heparin binding domain essential for virus attachment to the host. Ref.2. Post-translational modification: May carry a lot of separate O-linked carbohydrate chains distributed among serine and threonine residues . By similarity.Palmitoylated . By similarity. Sequence similarities: Belongs to the pneumoviruses glycoprotein G family.

1 mg (E-Coli)

1375 USD

1 mg (Yeast)

1835