protein

Recombinant Human D-glucuronyl C5-epimerase

MBS1149096

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human D-glucuronyl C5-epimerase

D-glucuronyl C5-epimerase

Heparan sulfate C5-epimerase; Hsepi; Heparin/heparan sulfate:glucuronic acid C5-epimerase; Heparosan-N-sulfate-glucuronate 5-epimerase

D-glucuronyl C5-epimerase; D-glucuronyl C5-epimerase; D-glucuronyl C5-epimerase; glucuronic acid epimerase; Heparan sulfate C5-epimerase; Hsepi; Heparin/heparan sulfate:glucuronic acid C5-epimerase; Heparosan-N-sulfate-glucuronate 5-epimerase

GLCE

GLCE; GLCE; HSEPI; ; Hsepi

GLCE_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

29-617

617

NKCSSDKAIQFPRRSSSGFRVDGFEKRAAASESNNYMNH
VAKQQSEEAFPQEQQKAPPVVGGFNSNVGSKVLGLKYEE
IDCLINDEHTIKGRREGNEVFLPFTWVEKYFDVYGKVVQ
YDGYDRFEFSHSYSKVYAQRAPYHPDGVFMSFEGYNVEV
RDRVKCISGVEGVPLSTQWGPQGYFYPIQIAQYGLSHYS
KNLTEKPPHIEVYETAEDRDKNKPNDWTVPKGCFMANVA
DKSRFTNVKQFIAPETSEGVS

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Cancer

Converts D-glucuronic acid residues adjacent to N-sulfate sugar residues to L-iduronic acid residues, both in maturing heparan sulfate (HS) and heparin chains. This is important for further modifications that determine the specificity of interactions between these glycosaminoglycans and proteins.

Homo sapiens D-glucuronyl C5-epimerase (GLCE) .Ghiselli G.Analysis of the DNA sequence and duplication history of human chromosome 15.Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A., Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.Nature 440:671-675(2006) Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.DNA Res. 5:355-364(1998) Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) Using engineered 2-O-sulfotransferase to determine the activity of heparan sulfate C5-epimerase and its mutants.Li K., Bethea H.N., Liu J.J. Biol. Chem. 285:11106-11113(2010) Uncovering a biphasic catalytic mode of C5-epimerase in heparan sulfate biosynthesis.Sheng J., Xu Y., Dulaney S.B., Huang X., Liu J.J. Biol. Chem. 287:20996-21002(2012)

51317380

NP_056369.1

NM_015554.1

O94923

70.9kD

Glycosaminoglycan Biosynthesis - Heparan Sulfate / Heparin Pathway (82984); Glycosaminoglycan Biosynthesis - Heparan Sulfate / Heparin Pathway (358); Glycosaminoglycan Biosynthesis, Heparan Sulfate Backbone Pathway (413365); Glycosaminoglycan Biosynthesis, Heparan Sulfate Backbone Pathway (468252); Glycosaminoglycan Metabolism Pathway (1269972); HS-GAG Biosynthesis Pathway (1269982); Heparan Sulfate/heparin (HS-GAG) Metabolism Pathway (1269980); Metabolic Pathways (132956); Metabolism Pathway (1269956); Metabolism Of Carbohydrates Pathway (1269957)

Heparan sulfate (HS) is a negatively charged cell surface polysaccharide required for the biologic activities of circulating extracellular ligands. GLCE is responsible for epimerization of D-glucuronic acid (GlcA) to L-iduronic acid (IdoA) of HS, which endows the nascent polysaccharide chain with the ability to bind growth factors and cytokines (Ghiselli and Agrawal, 2005 [PubMed 15853773]).[supplied by OMIM, Jun 2008]

GLCE: Converts D-glucuronic acid residues adjacent to N- sulfate sugar residues to L-iduronic acid residues, both in maturing heparan sulfate (HS) and heparin chains. This is important for further modifications that determine the specificity of interactions between these glycosaminoglycans and proteins. Belongs to the D-glucuronyl C5-epimerase family. Protein type: EC 5.1.3.17; Isomerase; Glycan Metabolism - heparan sulfate biosynthesis; Membrane protein, integral. Chromosomal Location of Human Ortholog: 15q23. Cellular Component: Golgi apparatus; Golgi membrane; integral to membrane. Molecular Function: heparosan-N-sulfate-glucuronate 5-epimerase activity; racemase and epimerase activity, acting on carbohydrates and derivatives; UDP-glucuronate 5'-epimerase activity. Biological Process: carbohydrate metabolic process; glycosaminoglycan biosynthetic process; glycosaminoglycan metabolic process; heparan sulfate proteoglycan biosynthetic process; heparin biosynthetic process

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

1 mg (E-Coli)

1180

1 mg (Yeast)

1835