catalog number :
MBS1148225
products type :
Recombinant Protein
products full name :
Recombinant Rat Regucalcin
products short name :
Regucalcin
other names :
regucalcin; Regucalcin; regucalcin; regucalcin (senescence marker protein-30); Gluconolactonase (EC:3.1.1.17); GNL; Senescence marker protein 30; SMP-30
other gene names :
Rgn; Rgn; Rc; GNL; Reguc; Smp30; RC; GNL; SMP-30
uniprot entry name :
RGN_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-299
sequence :
MSSIKIECVLRENYRCGESPVWEEASKCLLFVDIPSKTV
CRWDSISNRVQRVGVDAPVSSVALRQSGGYVATIGTKFC
ALNWEDQSVFILAMVDEDKKNNRFNDGKVDPAGRYFAGT
MAEETAPAVLERHQGSLYSLFPDHSVKKYFDQVDISNGL
DWSLDHKIFYYIDSLSYTVDAFDYDLPTGQISNRRTVYK
MEKDEQIPDGMCIDVEGKLWVACYNGGRVIRLDPETGKR
LQTVKLPVDKTTSCCFGGKDY
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
ncbi acc num :
NP_113734.1
ncbi gb acc num :
NM_031546.1
ncbi mol weight :
49.37kD
ncbi pathways :
Ascorbate And Aldarate Metabolism Pathway (83325); Ascorbate And Aldarate Metabolism Pathway (293); Ascorbate Biosynthesis, Animals, Glucose-1P = Ascorbate Pathway (434751); Ascorbate Biosynthesis, Animals, Glucose-1P = Ascorbate Pathway (468309); Carbon Metabolism Pathway (816129); Carbon Metabolism Pathway (817567); Degradation Of Aromatic Compounds Pathway (843607); Degradation Of Aromatic Compounds Pathway (717401); L-ascorbate Biosynthesis IV Pathway (138460); Metabolic Pathways (132933)
ncbi summary :
binds calcium ions; induces increased activity of the sarcoplasmic reticulum calcium-transporting ATPase [RGD, Feb 2006]
uniprot summary :
RGN: Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca(2+) signaling, and Ca(2+)-dependent cellular processes and enzyme activities. Belongs to the SMP-30/CGR1 family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: EC 3.1.1.17. Cellular Component: cytoplasm; cytosol; nucleoplasm; nucleus. Molecular Function: calcium ion binding; enzyme regulator activity; gluconolactonase activity; zinc ion binding. Biological Process: aging; cellular calcium ion homeostasis; kidney development; L-ascorbic acid biosynthetic process; liver development; negative regulation of apoptosis; negative regulation of cyclic-nucleotide phosphodiesterase activity; negative regulation of epithelial cell proliferation; negative regulation of nitric oxide biosynthetic process; negative regulation of phosphoprotein phosphatase activity; negative regulation of protein amino acid phosphorylation; negative regulation of protein kinase activity; positive regulation of ATPase activity; positive regulation of fatty acid biosynthetic process; positive regulation of GTPase activity; regulation of calcium-mediated signaling; spermatogenesis