product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Escherichia coli (strain K12) Protease 7
catalog :
MBS1147844
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS1147844
products type :
Recombinant Protein
products full name :
Recombinant Escherichia coli (strain K12) Protease 7
products short name :
Protease 7
products name syn :
Omptin; Outer membrane protein 3B; Protease A; Protease VII
other names :
DLP12 prophage; outer membrane protease VII; outer membrane protein 3b; Protease 7; DLP12 prophage; outer membrane protease VII; outer membrane protein 3b; Omptin; Outer membrane protein 3B; Protease A; Protease VII
products gene name :
ompT
other gene names :
ompT; ompT; ECK0557; JW0554
uniprot entry name :
OMPT_ECOLI
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
21-317; Mature full length protein
sequence length :
317
sequence :
STETLSFTPDNINADISLGTLSGKTKERVYLAEEGGRKV
SQLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRG
GNMVDQDWMDSSNPGTWTDESRHPDTQLNYANEFDLNIK
GWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSSEEGF
RDDIGSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELG
GTFKYSGWVESSDNDEHYDPGKRITYRSKVKDQNYYSVA
VNAGYYVTPNAKVYVEGAWNRVTNKKGNTSLYDHNNNTS
DYSKNGAGIENYNFITTAGLKYTF
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Protease that can cleave T7 RNA polymerase, ferric enterobactin receptor protein (FEP), antimicrobial peptide protamine and other proteins. This protease has a specificity for paired basic residues.
products references :
Complete nucleotide sequence and deduced amino acid sequence of the ompT gene of Escherichia coli K-12.Grodberg J., Lundrigan M.D., Toledo D.L., Mangel W.F., Dunn J.J.Nucleic Acids Res. 16:1209-1209(1988) Purification, characterization, and primary structure of Escherichia coli protease VII with specificity for paired basic residues identity of protease VII and OmpT.Sugimura K., Nisihihara T.J. Bacteriol. 170:5625-5632(1988) Sequence of minutes 4-25 of Escherichia coli.Chung E., Allen E., Araujo R., Aparicio A.M., Davis K., Duncan M., Federspiel N., Hyman R., Kalman S., Komp C., Kurdi O., Lew H., Lin D., Namath A., Oefner P., Roberts D., Schramm S., Davis R.W. The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map.Oshima T., Aiba H., Baba T., Fujita K., Hayashi K., Honjo A., Ikemoto K., Inada T., Itoh T., Kajihara M., Kanai K., Kashimoto K., Kimura S., Kitagawa M., Makino K., Masuda S., Miki T., Mizobuchi K., Mori H., Motomura K., Nakamura Y., Nashimoto H., Nishio Y., Saito N., Sampei G., Seki Y., Tagami H., Takemoto K., Wada C., Yamamoto Y., Yano M., Horiuchi T.DNA Res. 3:137-155(1996) Extraction of membrane proteins by differential solubilization for separation using two-dimensional gel electrophoresis.Molloy M.P., Herbert B.R., Walsh B.J., Tyler M.I., Traini M., Sanchez J.-C., Hochstrasser D.F., Williams K.L., Gooley A.A.Electrophoresis 19:837-844(1998) Identification of OmpT as the protease that hydrolyzes the antimicrobial peptide protamine before it enters growing cells of Escherichia coli.Stumpe S., Schmid R., Stephens D.L., Georgiou G., Bakker E.P.J. Bacteriol. 180:4002-4006(1998) In vitro folding, purification and characterization of Escherichia coli outer membrane protease ompT.Kramer R.A., Zandwijken D., Egmond M.R., Dekker N.Eur. J. Biochem. 267:885-893(2000) Identification of essential acidic residues of outer membrane protease OmpT supports a novel active site.Kramer R.A., Vandeputte-Rutten L., de Roon G.J., Gros P., Dekker N., Egmond M.R.FEBS Lett. 505:426-430(2001) Crystal structure of the outer membrane protease OmpT from Escherichia coli suggests a novel catalytic site.Vandeputte-Rutten L., Kramer R.A., Kroon J., Dekker N., Egmond M.R., Gros P.EMBO J. 20:5033-5039(2001)
ncbi gi num :
16128548
ncbi acc num :
NP_415097.1
ncbi gb acc num :
NC_000913.3
uniprot acc num :
P09169
ncbi mol weight :
37.6kD
ncbi summary :
Mg(2+) stimulon-PhoPQ regulon, EvgAS-PhoPQ cascade enhanced-expression subset. [More information is available at EcoGene: EG10673]. OmpT is an outer membrane protease with specificity for paired basic residues ; detailed studies on substrate specificity have been performed . [More information is available at EcoCyc: EG10673].
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
950
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1170
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!