Recombinant Human Transcription intermediary factor 1-alpha | MyBioSource MBS1147673 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Transcription intermediary factor 1-alpha

catalog :

MBS1147673

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1147673

products type :

Recombinant Protein

products full name :

Recombinant Human Transcription intermediary factor 1-alpha

products short name :

Transcription intermediary factor 1-alpha

products name syn :

E3 ubiquitin-protein ligase TRIM24; RING finger protein 82; Tripartite motif-containing protein 24

other names :

transcription intermediary factor 1-alpha isoform b; Transcription intermediary factor 1-alpha; transcription intermediary factor 1-alpha; tripartite motif containing 24; E3 ubiquitin-protein ligase TRIM24; RING finger protein 82; Tripartite motif-containing protein 24

products gene name :

TRIM24

other gene names :

TRIM24; TRIM24; PTC6; TF1A; TIF1; RNF82; TIF1A; hTIF1; TIF1ALPHA; RNF82; TIF1; TIF1A; TIF1-alpha

uniprot entry name :

TIF1A_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

891-1012

sequence length :

1016

sequence :

KKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVP
LTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVAD
FRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPE
KRFPK

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Epigenetics and Nuclear Signaling

products description :

Transcriptional coactivator that interacts with numerous nuclear receptors and coactivators and modulates the transcription of target genes. Interacts with chromatin depending on histone H3 modifications, having the highest affinity for histone H3 that is both unmodified at 'Lys-4' (H3K4me0) and acetylated at 'Lys-23' (H3K23ac). Has E3 protein-ubiquitin ligase activity. Promotes ubiquitination and proteasomal degradation of p53/TP53. Plays a role in the regulation of cell proliferation and apoptosis, at least in part via its effects on p53/TP53 levels. Up-regulates ligand-dependent transcription activation by AR, GCR/NR3C1, thyroid hormone receptor (TR) and ESR1. Modulates transcription activation by retinoic acid (RA) receptors, including RARA. Plays a role in regulating retinoic acid-dependent proliferation of hepatocytes.

products references :

Differential interaction of nuclear receptors with the putative human transcriptional coactivator hTIF1.Thenot S., Henriquet C., Rochefort H., Cavailles V.J. Biol. Chem. 272:12062-12068(1997) TIF1gamma, a novel member of the transcriptional intermediary factor 1 family.Venturini L., You J., Stadler M., Galien R., Lallemand V., Koken M.H.M., Mattei M.-G., Ganser A., Chambon P., Losson R., De The H.Oncogene 18:1209-1217(1999) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Human chromosome 7 DNA sequence and biology.Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S., Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.Science 300:767-772(2003)

ncbi gi num :

47419909

ncbi acc num :

NP_003843.3

ncbi gb acc num :

NM_003852.3

uniprot acc num :

O15164

ncbi mol weight :

30.47kD

ncbi pathways :

Disease Pathway (1268854); Diseases Of Signal Transduction Pathway (1268855); FGFR1 Mutant Receptor Activation Pathway (1268865); Regulation Of Androgen Receptor Activity Pathway (138027); Signaling By FGFR In Disease Pathway (1268863); Signaling By FGFR1 Fusion Mutants Pathway (1268867); Signaling By FGFR1 In Disease Pathway (1268864)

ncbi summary :

The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains - a RING, a B-box type 1 and a B-box type 2 - and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

uniprot summary :

TRIM24: an atypical protein kinase that functions as a transcriptional coactivator. Originally identified as a mammalian protein that enhances the AF-2 activity of the retinoid X receptor (RXR) in a yeast genetic screen. Binds to nuclear receptors in an agonist and AF2-activating domain (AF2-AD) dependent manner. Binding to the agonist-nuclear receptor complex induces its own hyperphosphorylation as well as the phosphorylation of TFIIEa, TAFII28, and TAFII55. Belongs to a family of nuclear proteins that includes TIF1b and TIF1g. TIF1 proteins are characterized by an N-terminal region that contains a RING finger-B boxes-coiled coil (RBCC) motif, a poorly conserved central region, a C-terminal region that contains a PHD finger, and a bromodomain. Interacts with the heterochromatin-associated proteins HP1a, MOD1 (HP1b), and MOD2 (HP1g) and with the transcriptional repression domain KRAB, which is present in many Kruppel-type (C2H2) zinc finger proteins. May act as a repressor through the formation of transcriptionally inactive heterochromatin. Two splice variant isoforms have been described. Protein type: Ubiquitin conjugating system; Tumor suppressor; Transcription, coactivator/corepressor; Kinase, protein; EC 6.3.2.-; Nuclear receptor co-regulator; Protein kinase, atypical; ATYPICAL group; TIF1 family. Chromosomal Location of Human Ortholog: 7q32-q34. Cellular Component: cytosol; nucleus; perichromatin fibrils. Molecular Function: chromatin binding; estrogen response element binding; ligand-dependent nuclear receptor binding; ligase activity; methylated histone residue binding; p53 binding; protein binding; protein kinase activity; receptor binding; sequence-specific DNA binding; transcription coactivator activity; ubiquitin-protein ligase activity; zinc ion binding. Biological Process: calcium ion homeostasis; negative regulation of cell proliferation; negative regulation of transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; protein amino acid autophosphorylation; protein catabolic process; protein ubiquitination; regulation of apoptosis; regulation of protein stability; transcription from RNA polymerase II promoter. Disease: Thyroid Carcinoma, Papillary

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (Yeast)

price5 :

750

more info or order :

MyBioSource product webpage