Recombinant Human Prostate stem cell antigen | MyBioSource MBS1147360 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Prostate stem cell antigen

catalog :

MBS1147360

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1147360

products type :

Recombinant Protein

products full name :

Recombinant Human Prostate stem cell antigen

products short name :

Prostate stem cell antigen

other names :

Prostate stem cell antigen

products gene name :

PSCA

other gene names :

PSCA

uniprot entry name :

PSCA_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

21-95a

sequence length :

123

sequence :

LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLL
TVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Cancer

products description :

May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro.

products references :

Prostate stem cell antigen a cell surface marker overexpressed in prostate cancer.Reiter R.E., Gu Z., Watabe T., Thomas G., Szigeti K., Davis E., Wahl M., Nisitani S., Yamashiro J., le Beau M.M., Losa M., Witte O.N.Proc. Natl. Acad. Sci. U.S.A. 95:1735-1740(1998) Reduced expression of PSCA, a member of the LY-6 family of cell surface antigens, in bladder, esophagus, and stomach tumors.Bahrenberg G., Brauers A., Joost H.G., Jakse G.Biochem. Biophys. Res. Commun. 275:783-788(2000) DNA sequence and analysis of human chromosome 8.Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T., Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.Nature 439:331-335(2006) The secreted protein discovery initiative (SPDI) , a large-scale effort to identify novel human secreted and transmembrane proteins a bioinformatics assessment.Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.Genome Res. 13:2265-2270(2003) Signal peptide prediction based on analysis of experimentally verified cleavage sites.Zhang Z., Henzel W.J.Protein Sci. 13:2819-2824(2004) Prostate stem cell antigen (PSCA) expression increases with high gleason score, advanced stage and bone metastasis in prostate cancer.Gu Z., Thomas G., Yamashiro J., Shintaku I.P., Dorey F., Raitano A., Witte O.N., Said J.W., Loda M., Reiter R.E.Oncogene 19:1288-1296(2000) Genetic variation in PSCA is associated with susceptibility to diffuse-type gastric cancer.The study group of millennium genome project for cancerSakamoto H., Yoshimura K., Saeki N., Katai H., Shimoda T., Matsuno Y., Saito D., Sugimura H., Tanioka F., Kato S., Matsukura N., Matsuda N., Nakamura T., Hyodo I., Nishina T., Yasui W., Hirose H., Hayashi M., Toshiro E., Ohnami S., Sekine A., Sato Y., Totsuka H., Ando M., Takemura R., Takahashi Y., Ohdaira M., Aoki K., Honmyo I., Chiku S., Aoyagi K., Sasaki H., Ohnami S., Yanagihara K., Yoon K.-A., Kook M.-C., Lee Y.-S., Park S.R., Kim C.G., Choi I.J., Yoshida T., Nakamura Y., Hirohashi S.Nat. Genet. 40:730-740(2008)

uniprot acc num :

O43653

ncbi mol weight :

13 kD

uniprot summary :

PSCA: May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro. Protein type: Membrane protein, GPI anchor. Chromosomal Location of Human Ortholog: 8q24.2. Cellular Component: plasma membrane

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

0.05 mg (Baculovirus)

price4 :

805

size5 :

0.05 mg (Mammalian-Cell)

price5 :

1030

more info or order :

MyBioSource product webpage