product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Trans-activator protein BZLF1
catalog :
MBS1146552
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1146552
products type :
Recombinant Protein
products full name :
Recombinant Trans-activator protein BZLF1
products short name :
Trans-activator protein BZLF1
products name syn :
Zebra
other names :
BZLF1; Trans-activator protein BZLF1; BZLF1; Zebra
products gene name :
BZLF1
other gene names :
BZLF1; BZLF1; EB1
uniprot entry name :
BZLF1_EBVB9
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-245
sequence length :
245
sequence :
MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGP
SQAPLPCVLWPVLPEPLPQGQLTAYHVSTAPTGSWFSAP
QPAPENAYQAYAAPQLFPVSDITQNQQTNQAGGEAPQPG
DNSTVQTAAAVVFACPGANQGQQLADIGVPQPAPVAAPA
RRTRKPQQPESLEECDSELEIKRYKNRVASRKCRAKFKQ
LLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRT
PDVLHEDLLNF
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Plays a key role in the switch from latent infection to lytic cycle producing new virions. Acts as a transcription factor, inducing early lytic cycle genes, and as a origin binding protein for genome replication. BZLF1 activates the promoter of another EBV gene (BSLF2+BMLF1).
products references :
DNA sequence and expression of the B95-8 Epstein-Barr virus genome.Baer R., Bankier A.T., Biggin M.D., Deininger P.L., Farrell P.J., Gibson T.J., Hatfull G., Hudson G.S., Satchwell S.C., Seguin C., Tuffnell P.S., Barrell B.G.Nature 310:207-211(1984) Epstein-Barr virus gene expression in P3HR1-superinfected Raji cells.Biggin M., Bodescot M., Perricaudet M., Farrel P.J. Virol. 61:3120-3132(1987) Epstein-Barr virus BZLF1 trans-activator specifically binds to a consensus AP-1 site and is related to c-fos.Farrel P.J., Rowe D.T., Rooney C.M., Kouzarides T.EMBO J. 8:127-132(1989) Structure and function of the Epstein-Barr virus BZLF1 protein.Packham G., Economou A., Rooney C.M., Rowe D.T., Farrel P.J.J. Virol. 64:2110-2116(1990) The BZLF1 protein of EBV has a coiled coil dimerisation domain without a heptad leucine repeat but with homology to the C/EBP leucine zipper.Kouzarides T., Packham G., Cook A., Farrell P.J.Oncogene 6:195-204(1991) A transcription factor with homology to the AP-1 family links RNA transcription and DNA replication in the lytic cycle of Epstein-Barr virus.Schepers A., Pich D., Hammerschmidt W.EMBO J. 12:3921-3929(1993) The PKC targeting protein RACK1 interacts with the Epstein-Barr virus activator protein BZLF1.Baumann M., Gires O., Kolch W., Mischak H., Zeidler R., Pich D., Hammerschmidt W.Eur. J. Biochem. 267:3891-3901(2000) Ubinuclein, a novel nuclear protein interacting with cellular and viral transcription factors.Aho S., Buisson M., Pajunen T., Ryoo Y.W., Giot J.-F., Gruffat H., Sergeant A., Uitto J.J. Cell Biol. 148:1165-1176(2000) Epstein-Barr virus BZLF1 gene, a switch from latency to lytic infection, is expressed as an immediate-early gene after primary infection of B lymphocytes.Wen W., Iwakiri D., Yamamoto K., Maruo S., Kanda T., Takada K.J. Virol. 81:1037-1042(2007) TORC2, a coactivator of cAMP-response element-binding protein, promotes Epstein-Barr virus reactivation from latency through interaction with viral BZLF1 protein.Murata T., Sato Y., Nakayama S., Kudoh A., Iwahori S., Isomura H., Tajima M., Hishiki T., Ohshima T., Hijikata M., Shimotohno K., Tsurumi T.J. Biol. Chem. 284:8033-8041(2009) Interaction of Epstein-Barr virus BZLF1 C-terminal tail structure and core zipper is required for DNA replication but not for promoter transactivation.McDonald C.M., Petosa C., Farrell P.J.J. Virol. 83:3397-3401(2009) Structural basis of lytic cycle activation by the Epstein-Barr virus ZEBRA protein.Petosa C., Morand P., Baudin F., Moulin M., Artero J.B., Muller C.W.Mol. Cell 21:565-572(2006)
ncbi gi num :
82503229
ncbi acc num :
YP_401673.1
ncbi gb acc num :
NC_007605.1
uniprot acc num :
P03206
ncbi mol weight :
42.8kD
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
995
size5 :
1 mg (E-Coli)
price5 :
1180
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!