Recombinant Human Laminin subunit alpha-5 | MyBioSource MBS1145831 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Laminin subunit alpha-5

catalog :

MBS1145831

quantity :

0.01 mg (E-Coli)

price :

110 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1145831

products type :

Recombinant Protein

products full name :

Recombinant Human Laminin subunit alpha-5

products short name :

Laminin subunit alpha-5

products name syn :

Laminin-10 subunit alpha; Laminin-11 subunit alpha; Laminin-15 subunit alpha

other names :

laminin subunit alpha-5; Laminin subunit alpha-5; laminin subunit alpha-5; laminin subunit alpha 5; Laminin-10 subunit alpha; Laminin-11 subunit alpha; Laminin-15 subunit alpha

products gene name :

LAMA5

other gene names :

LAMA5; LAMA5; KIAA0533; KIAA1907

uniprot entry name :

LAMA5_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

3401-3692

sequence length :

3695

sequence :

FVAQMEGLGTRLRAQSRQRSRPGRWHKVSVRWEKNRILL
VTDGARAWSQEGPHRQHQGAEHPQPHTLFVGGLPASSHS
SKLPVTVGFSGCVKRLRLHGRPLGAPTRMAGVTPCILGP
LEAGLFFPGSGGVITLDLPGATLPDVGLELEVRPLAVTG
LIFHLGQARTPPYLQLQVTEKQVLLRADDGAGEFSTSVT
RPSVLCDGQWHRLAVMKSGNVLRLEVDAQSNHTVGPLLA
AAAGAPAPLYLGGLPEPMAVQPWPPAYCGCMRRLAVNRS
PVAMTRSVEVHGAVGASGC

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

other info2 :

Species: Homo sapiens (Human)

products categories :

Neuroscience

products description :

Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during emembryonic development by interacting with other extracellular matrix components.

products references :

Recombinant human laminin-10 (alpha5beta1gamma1). Production, purification, and migration-promoting activity on vascular endothelial cells." Doi M., Thyboll J., Kortesmaa J., Jansson K., Iivanainen A., Parvardeh M., Timpl R., Hedin U., Swedenborg J., Tryggvason K. J. Biol. Chem. 277:12741-12748(2002)

ncbi gi num :

21264602

ncbi acc num :

NP_005551.3

ncbi gb acc num :

NM_005560.4

uniprot acc num :

O15230

ncbi mol weight :

47.12kD

ncbi pathways :

Alpha6-Beta4 Integrin Signaling Pathway (198807); Amoebiasis Pathway (167324); Amoebiasis Pathway (167191); Degradation Of The Extracellular Matrix Pathway (1270257); ECM Proteoglycans Pathway (1270256); ECM-receptor Interaction Pathway (83068); ECM-receptor Interaction Pathway (479); Extracellular Matrix Organization Pathway (1270244); Focal Adhesion Pathway (198795); Focal Adhesion Pathway (83067)

ncbi summary :

This gene encodes one of the vertebrate laminin alpha chains. Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. The protein encoded by this gene is the alpha-5 subunit of of laminin-10 (laminin-511), laminin-11 (laminin-521) and laminin-15 (laminin-523). [provided by RefSeq, Jun 2013]

uniprot summary :

LAMA5: Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Protein type: Secreted, signal peptide; Secreted; Motility/polarity/chemotaxis; Extracellular matrix. Chromosomal Location of Human Ortholog: 20q13.2-q13.3. Cellular Component: basal lamina; basement membrane; extracellular matrix; extracellular region; extracellular space; laminin-10 complex; laminin-5 complex; nucleus. Molecular Function: integrin binding; structural molecule activity. Biological Process: angiogenesis; cell differentiation; cell migration; cell proliferation; cell recognition; cilium biogenesis; cytoskeleton organization and biogenesis; embryonic development; endothelial cell differentiation; extracellular matrix disassembly; extracellular matrix organization and biogenesis; focal adhesion formation; hair follicle development; integrin-mediated signaling pathway; lung development; morphogenesis of a polarized epithelium; morphogenesis of embryonic epithelium; muscle development; neural crest cell migration; odontogenesis of dentine-containing teeth; regulation of cell adhesion; regulation of cell migration; regulation of cell proliferation; regulation of embryonic development; ureteric bud branching

size1 :

0.01 mg (E-Coli)

price1 :

110 USD

size2 :

0.05 mg (E-Coli)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.5 mg (E-Coli)

price4 :

750

size5 :

0.05 mg (Baculovirus)

price5 :

1050

more info or order :

MyBioSource product webpage