product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Laminin subunit alpha-5
catalog :
MBS1145831
quantity :
0.01 mg (E-Coli)
price :
110 USD
more info or order :
product information
catalog number :
MBS1145831
products type :
Recombinant Protein
products full name :
Recombinant Human Laminin subunit alpha-5
products short name :
Laminin subunit alpha-5
products name syn :
Laminin-10 subunit alpha; Laminin-11 subunit alpha; Laminin-15 subunit alpha
other names :
laminin subunit alpha-5; Laminin subunit alpha-5; laminin subunit alpha-5; laminin subunit alpha 5; Laminin-10 subunit alpha; Laminin-11 subunit alpha; Laminin-15 subunit alpha
products gene name :
LAMA5
other gene names :
LAMA5; LAMA5; KIAA0533; KIAA1907
uniprot entry name :
LAMA5_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
3401-3692
sequence length :
3695
sequence :
FVAQMEGLGTRLRAQSRQRSRPGRWHKVSVRWEKNRILL
VTDGARAWSQEGPHRQHQGAEHPQPHTLFVGGLPASSHS
SKLPVTVGFSGCVKRLRLHGRPLGAPTRMAGVTPCILGP
LEAGLFFPGSGGVITLDLPGATLPDVGLELEVRPLAVTG
LIFHLGQARTPPYLQLQVTEKQVLLRADDGAGEFSTSVT
RPSVLCDGQWHRLAVMKSGNVLRLEVDAQSNHTVGPLLA
AAAGAPAPLYLGGLPEPMAVQPWPPAYCGCMRRLAVNRS
PVAMTRSVEVHGAVGASGC
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Homo sapiens (Human)
products categories :
Neuroscience
products description :
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during emembryonic development by interacting with other extracellular matrix components.
products references :
Recombinant human laminin-10 (alpha5beta1gamma1). Production, purification, and migration-promoting activity on vascular endothelial cells." Doi M., Thyboll J., Kortesmaa J., Jansson K., Iivanainen A., Parvardeh M., Timpl R., Hedin U., Swedenborg J., Tryggvason K. J. Biol. Chem. 277:12741-12748(2002)
ncbi gi num :
21264602
ncbi acc num :
NP_005551.3
ncbi gb acc num :
NM_005560.4
uniprot acc num :
O15230
ncbi mol weight :
47.12kD
ncbi pathways :
Alpha6-Beta4 Integrin Signaling Pathway (198807); Amoebiasis Pathway (167324); Amoebiasis Pathway (167191); Degradation Of The Extracellular Matrix Pathway (1270257); ECM Proteoglycans Pathway (1270256); ECM-receptor Interaction Pathway (83068); ECM-receptor Interaction Pathway (479); Extracellular Matrix Organization Pathway (1270244); Focal Adhesion Pathway (198795); Focal Adhesion Pathway (83067)
ncbi summary :
This gene encodes one of the vertebrate laminin alpha chains. Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. The protein encoded by this gene is the alpha-5 subunit of of laminin-10 (laminin-511), laminin-11 (laminin-521) and laminin-15 (laminin-523). [provided by RefSeq, Jun 2013]
uniprot summary :
LAMA5: Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Protein type: Secreted, signal peptide; Secreted; Motility/polarity/chemotaxis; Extracellular matrix. Chromosomal Location of Human Ortholog: 20q13.2-q13.3. Cellular Component: basal lamina; basement membrane; extracellular matrix; extracellular region; extracellular space; laminin-10 complex; laminin-5 complex; nucleus. Molecular Function: integrin binding; structural molecule activity. Biological Process: angiogenesis; cell differentiation; cell migration; cell proliferation; cell recognition; cilium biogenesis; cytoskeleton organization and biogenesis; embryonic development; endothelial cell differentiation; extracellular matrix disassembly; extracellular matrix organization and biogenesis; focal adhesion formation; hair follicle development; integrin-mediated signaling pathway; lung development; morphogenesis of a polarized epithelium; morphogenesis of embryonic epithelium; muscle development; neural crest cell migration; odontogenesis of dentine-containing teeth; regulation of cell adhesion; regulation of cell migration; regulation of cell proliferation; regulation of embryonic development; ureteric bud branching
size1 :
0.01 mg (E-Coli)
price1 :
110 USD
size2 :
0.05 mg (E-Coli)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.5 mg (E-Coli)
price4 :
750
size5 :
0.05 mg (Baculovirus)
price5 :
1050
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!