protein

Recombinant Escherichia coli NAD(P) transhydrogenase subunit alpha

MBS1145373

INQUIRE

INQUIRE

Recombinant Protein

Recombinant Escherichia coli NAD(P) transhydrogenase subunit alpha

NAD(P) transhydrogenase subunit alpha

Nicotinamide nucleotide transhydrogenase subunit alpha; Pyridine nucleotide transhydrogenase subunit alpha

pyridine nucleotide transhydrogenase, alpha subunit; NAD(P) transhydrogenase subunit alpha; pyridine nucleotide transhydrogenase, alpha subunit; Nicotinamide nucleotide transhydrogenase subunit alpha; Pyridine nucleotide transhydrogenase subunit alpha

pntA

pntA; pntA; ECK1598; JW1595

PNTA_ECOLI

E Coli or Yeast or Baculovirus or Mammalian Cell

1-401

510

MRIGIPRERLTNETRVAATPKTVEQLLKLGFTVAVESGA
GQLASFDDKAFVQAGAEIVEGNSVWQSEIILKVNAPLDD
EIALLNPGTTLVSFIWPAQNPELMQKLAERNVTVMAMDS
VPRISRAQSLDALSSMANIAGYRAIVEAAHEFGRFFTGQ
ITAAGKVPPAKVMVIGAGVAGLAAIGAANSLGAIVRAFD
TRPEVKEQVQSMGAEFLELDFKEEAGSGDGYAKVMSDAF
IKAEMELFAAQAKEVDIIVTT

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

The transhydrogenation between NADH and NADP is coupled to respiration and ATP hydrolysis and functions as a proton pump across the membrane.

Nucleotide sequence of the pntA and pntB genes encoding the pyridine nucleotide transhydrogenase of Escherichia coli.Clarke D.M., Loo T.W., Gillam S., Bragg P.D.Eur. J. Biochem. 158:647-653(1986) A mutation at Gly314 of the beta subunit of the Escherichia coli pyridine nucleotide transhydrogenase abolishes activity and affects the NADP(H) -induced conformational change.Ahmad S., Glavas N.A., Bragg P.D.Eur. J. Biochem. 207:733-739(1992) A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map.Aiba H., Baba T., Fujita K., Hayashi K., Inada T., Isono K., Itoh T., Kasai H., Kashimoto K., Kimura S., Kitakawa M., Kitagawa M., Makino K., Miki T., Mizobuchi K., Mori H., Mori T., Motomura K., Nakade S., Nakamura Y., Nashimoto H., Nishio Y., Oshima T., Saito N., Sampei G., Seki Y., Sivasundaram S., Tagami H., Takeda J., Takemoto K., Takeuchi Y., Wada C., Yamamoto Y., Horiuchi T.DNA Res. 3:363-377(1996) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) Topological analysis of the pyridine nucleotide transhydrogenase of Escherichia coli using proteolytic enzymes.Tong R.C., Glavas N.A., Bragg P.D.Biochim. Biophys. Acta 1080:19-28(1991) Global topology analysis of the Escherichia coli inner membrane proteome.Daley D.O., Rapp M., Granseth E., Melen K., Drew D., von Heijne G.Science 308:1321-1323(2005) X-ray structure of domain I of the proton-pumping membrane protein transhydrogenase from Escherichia coli.Johansson T., Oswald C., Pedersen A., Toernroeth S., Okvist M., Karlsson B.G., Rydstroem J., Krengel U.J. Mol. Biol. 352:299-312(2005) Structure determination of a transient complex by NMR using paramagnetic distance restraints - the complex of the soluble domains of Escherichia coli transhydrogenase.Johansson T., Pedersen A., Leckner J., Karlsson B.G.Submitted (MAY-2005) to the PDB data bank

16129561

NP_416120.1

NC_000913.3

P07001

44.7kD

Metabolic Pathways (131985); NAD Phosphorylation And Dephosphorylation Pathway (66); NAD Phosphorylation And Dephosphorylation Pathway (138363); NAD Phosphorylation And Transhydrogenation Pathway (982203); Nicotinate And Nicotinamide Metabolism Pathway (1092); Nicotinate And Nicotinamide Metabolism Pathway (400)

[More information is available at EcoGene: EG10744]. Pyridine nucleotide transhydrogenase catalyzes the reversible transfer of a hydride ion equivalent between NAD and NADP. [More information is available at EcoCyc: EG10744].

INQUIRE

INQUIRE