Recombinant Varicella-zoster virus Envelope glycoprotein E (gE) | MyBioSource MBS1141836 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Varicella-zoster virus Envelope glycoprotein E (gE)

catalog :

MBS1141836

quantity :

1 mg (E Coli Derived

price :

2275 USD

product information

catalog number :

MBS1141836

products type :

Recombinant Protein

products full name :

Recombinant Varicella-zoster virus Envelope glycoprotein E (gE)

products short name :

Envelope glycoprotein E (gE)

products name syn :

Recombinant Envelope glycoprotein E (gE); Envelope glycoprotein E; gE

other names :

envelope glycoprotein E; Envelope glycoprotein E; type 1 membrane protein; contains a signal peptide; complexed with envelope glycoprotein I to form an Fc-receptor; envelope glycoprotein E

products gene name syn :

gE; ORF68

other gene names :

ORF68; gE; gE

uniprot entry name :

GE_VZVD

host :

E Coli or Yeast

sequence positions :

31-623

sequence length :

623

sequence :

SVLRYDDFHTDEDKLDTNSVYEPYYHSDHAESSWVNRGE
SSRKAYDHNSPYIWPRNDYDGFLENAHEHHGVYNQGRGI
DSGERLMQPTQMSAQEDLGDDTGIHVIPTLNGDDRHKIV
NVDQRQYGDVFKGDLNPKPQGQRLIEVSVEENHPFTLRA
PIQRIYGVRYTETWSFLPSLTCTGDAAPAIQHICLKHTT
CFQDVVVDVDCAENTKEDQLAEISYRFQGKKEADQPWIV
VNTSTLFDELELDPPEIEPGVLKVLRTEKQYLGVYIWNM
RGSDGTSTYATFLVTWKGDEKTRNPTPAVTPQPRGAEFH
MWNYHSHVFSVGDTFSLAMHLQYKIHEAPFDLLLEWLYV
PIDPTCQPMRLYSTCLYHPNAPQCLSHMNSGCTFTSPHL
AQRVASTVYQNCEHADNYTAYCLGISHMEPSFGLILHDG
GTTLKFVDTPESLSGLYVFVVYFNGHVEAVAYTVVSTVD
HFVNAIEERGFPPTAGQPPATTKPKEITPVNPGTSPLLR
YAAWTGGLAAVVLLCLVIFLICTAKRMRVKAYRVDKSPY
NQSMYYAGLPVDDFEDSESTDTEEEFGNAIGGSHGGSSY
TVYIDKTR

purity :

>90%

form :

This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.

storage stability :

Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

other info1 :

Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Varicella-zoster virus (strain Dumas) (HHV-3) (Human herpesvirus 3)

other info2 :

Storage Buffer: PBS pH 7.4, 50% glycerol

ncbi gi num :

9625942

ncbi acc num :

NP_040190.1

ncbi gb acc num :

NC_001348.1

uniprot acc num :

P09259

ncbi mol weight :

69,956 Da

uniprot summary :

Function: Envelope glycoprotein that binds to the potential host cell entry receptor IDE.In epithelial cells, the heterodimer gE/gI is required for the cell-to-cell spread of the virus, by sorting nascent virions to cell junctions. Once the virus reaches the cell junctions, virus particles can spread to adjacent cells extremely rapidly through interactions with cellular receptors that accumulate at these junctions. Implicated in basolateral spread in polarized cells. In neuronal cells, gE/gI is essential for the anterograde spread of the infection throughout the host nervous system. Together with US9, the heterodimer gE/gI is involved in the sorting and transport of viral structural components toward axon tips . By similarity.The heterodimer gE/gI serves as a receptor for the Fc part of host IgG. Dissociation of gE/gI from IgG occurs at acidic pH. May thus be involved in anti-VZV antibodies bipolar bridging, followed by intracellular endocytosis and degradation, thereby interfering with host IgG-mediated immune responses . By similarity. Subunit structure: Interacts (via N-terminus) with host receptor IDE (via N-terminus). Interacts with gI; this interaction enhances the Fc receptor function of gE . By similarity. The heterodimer gE/gI interacts with the Fc part of host IgG. Ref.5. Subcellular location: Virion membrane; Single-pass type I membrane protein . By similarity. Host cell membrane; Single-pass type I membrane protein . By similarity. Host cell junction . By similarity. Host Golgi apparatus membrane; Single-pass membrane protein . By similarity. Host endosome membrane; Single-pass membrane protein . By similarity. Note: During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN), maybe through an interaction with PACS-1 sorting protein. The heterodimer gE/gI then redistributes to cell junctions to promote cell-cell spread later in the infection . By similarity. Ref.3 Ref.4. Post-translational modification: Phosphorylated on serines within the acidic cluster . Potential. Phosphorylation determines whether endocytosed viral gE traffics to the trans-Golgi network or recycles to the cell membrane . Potential. Sequence similarities: Belongs to the alphaherpesvirinae glycoprotein E family. Sequence caution: The sequence CAA25033.1 differs from that shown. Reason: Erroneous initiation.

size :

1 mg (E Coli Derived)

price :

2275 USD