VPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIH
EIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGG
AYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEF
NRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTF
IVDSVELLLMEE

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Escherichia coli F17 fimbrial protein | MBS1143730
- Recombinant Escherichia coli (strain K12) Protease 7 | MBS1147844
- Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB)
- Recombinant Enterobacteria phage T4 (Bacteriophage T4) Recombination and repair ...
- Recombinant Mycoplasma hyorhinis High affinity transport system protein p37
