ILKLLISRSNKQRQQIALTYKTLFGRDLTDDLKSELSGK
FETLLVALMVPAHLYDACELRNAIKGLGTLENVIIEIMA
SRTAAEVKNIKETYKKEFDSDLEKDIVGDTSGNFERLLV
SLVQANRDPVGKVDEGQVENDAKALFDAGENKWGTDEET
FISILSTRGVGHLRKVFDQYMTISGYQIEESIQSETGGH
FEKLLLAVVKSIRSIQGYLAE

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Rabies virus Nucleoprotein (N) | MBS1144134
- Recombinant Bovine respiratory syncytial virus Nucleoprotein | MBS1144192
- Recombinant Canis familiaris Matrix metalloproteinase-9 | MBS1145887
- Recombinant Human Prostate stem cell antigen | MBS1147360
- Recombinant Crimean-Congo hemorrhagic fever virus Nucleoprotein (N) | MBS1148370
