catalog number :
MBS1138720
products type :
Recombinant Protein
products full name :
Recombinant Human Growth/differentiation factor 11
products short name :
Growth/differentiation factor 11
products name syn :
Bone morphogenetic protein 11; BMP-11
other names :
growth/differentiation factor 11; Growth/differentiation factor 11; growth/differentiation factor 11; growth differentiation factor 11; Bone morphogenetic protein 11; BMP-11
products gene name :
GDF11
other gene names :
GDF11; GDF11; BMP11; BMP-11; BMP11; GDF-11; BMP-11
uniprot entry name :
GDF11_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
299-407
sequence :
NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYK
ANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTK
MSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Homo sapiens (Human)
products categories :
Neuroscience
products description :
Secreted signal that acts globally to specify positional identity along the anterior/posterior axis during development. Play critical roles in patterning both mesodermal and neural tissues and in establishing the skeletal pattern.
products references :
A novel BMP expressed in developing mouse limb, spinal cord, and tail bud is a potent mesoderm inducer in Xenopus embryos." Gamer L.W., Wolfman N.M., Celeste A.J., Hattersley G., Hewick R., Rosen V. Dev. Biol. 208:222-232(1999)
ncbi acc num :
NP_005802.1
ncbi gb acc num :
NM_005811.3
ncbi mol weight :
28.45kD
ncbi summary :
The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in mice and Xenopus suggest that this protein is involved in mesodermal formation and neurogenesis during embryonic development. [provided by RefSeq, Jul 2008]
uniprot summary :
GDF11: Secreted signal that acts globally to specify positional identity along the anterior/posterior axis during development. Play critical roles in patterning both mesodermal and neural tissues and in establishing the skeletal pattern. Belongs to the TGF-beta family. Protein type: Secreted, signal peptide; Secreted. Chromosomal Location of Human Ortholog: 12q13.2. Cellular Component: extracellular space; intracellular membrane-bound organelle; nucleoplasm; protein complex. Molecular Function: cytokine activity; growth factor activity; transforming growth factor beta receptor binding. Biological Process: camera-type eye morphogenesis; cell development; cell maturation; growth; mesoderm development; metanephros development; negative regulation of cell proliferation; negative regulation of neuron differentiation; nervous system development; palate development; pancreas development; regulation of apoptosis; regulation of MAPKKK cascade; skeletal development; spinal cord anterior/posterior patterning; ureteric bud development
size5 :
0.05 mg (Baculovirus)