product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human cytomegalovirus (strain AD169) (HHV-5) Envelope glycoprotein H
catalog :
MBS1138239
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1138239
products type :
Recombinant Protein
products full name :
Recombinant Human cytomegalovirus (strain AD169) (HHV-5) Envelope glycoprotein H
products short name :
Envelope glycoprotein H
other names :
Envelope glycoprotein H; Envelope glycoprotein H
products gene name :
gH
other gene names :
gH; UL75; gH
uniprot entry name :
GH_HCMVA
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
24-195
sequence length :
743
sequence :
RYGADAASEALDPHAFHLLLNTYGRPIRFLRENTTQCTY
NSSLRNSTVVRENAISFNFFQSYNQYYVFHMPRCLFAGP
LAEQFLNQVDLTETLERYQQRLNTYALVSKDLASYRSFS
QQLKAQDSLGQQPTTVPPPIDLSIPHVWMPPQTTPHDWK
GSHTTSGLHRPHFNQT
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. Fusion of with fibroblasts requires the additional receptor-binding protein gO, which forms a complex with gH/gL.
products references :
Identification and expression of a human cytomegalovirus glycoprotein with homology to the Epstein-Barr virus BXLF2 product, varicella-zoster virus gpIII, and herpes simplex virus type 1 glycoprotein H.Cranage M.P., Smith G.L., Bell S.E., Hart H., Brown C., Bankier A.T., Tomlinson P., Barrell B.G., Minson T.C.J. Virol. 62:1416-1422(1988) Analysis of the protein-coding content of the sequence of human cytomegalovirus strain AD169.Chee M.S., Bankier A.T., Beck S., Bohni R., Brown C.M., Cerny R., Horsnell T., Hutchison C.A. III, Kouzarides T., Martignetti J.A., Preddie E., Satchwell S.C., Tomlinson P., Weston K.M., Barrell B.G.Curr. Top. Microbiol. Immunol. 154:125-169(1990) The human cytomegalovirus genome revisited comparison with the chimpanzee cytomegalovirus genome.Davison A.J., Dolan A., Akter P., Addison C., Dargan D.J., Alcendor D.J., McGeoch D.J., Hayward G.S.J. Gen. Virol. 84:17-28(2003) ErratumDavison A.J., Dolan A., Akter P., Addison C., Dargan D.J., Alcendor D.J., McGeoch D.J., Hayward G.S.J. Gen. Virol. 84:1053-1053(2003) The human cytomegalovirus UL74 gene encodes the third component of the glycoprotein H-glycoprotein L-containing envelope complex.Huber M.T., Compton T.J. Virol. 72:8191-8197(1998) Identification of proteins in human cytomegalovirus (HCMV) particles the HCMV proteome.Varnum S.M., Streblow D.N., Monroe M.E., Smith P., Auberry K.J., Pasa-Tolic L., Wang D., Camp D.G. II, Rodland K., Wiley S., Britt W., Shenk T., Smith R.D., Nelson J.A.J. Virol. 78:10960-10966(2004) ErratumVarnum S.M., Streblow D.N., Monroe M.E., Smith P., Auberry K.J., Pasa-Tolic L., Wang D., Camp D.G. II, Rodland K., Wiley S., Britt W., Shenk T., Smith R.D., Nelson J.A.J. Virol. 78:13395-13395(2004)
ncbi gi num :
138313
ncbi acc num :
P12824.1
uniprot acc num :
P12824
ncbi mol weight :
35.8kD
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
size5 :
1 mg (Yeast)
price5 :
1835
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!