Recombinant Human Galectin-9 | MyBioSource MBS1136801 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Galectin-9

catalog :

MBS1136801

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1136801

products type :

Recombinant Protein

products full name :

Recombinant Human Galectin-9

products short name :

Galectin-9

products name syn :

Ecalectin; Tumor antigen HOM-HD-21

other names :

galectin-9 isoform short; Galectin-9; galectin-9; lectin, galactoside-binding, soluble, 9; Ecalectin; Tumor antigen HOM-HD-21

products gene name :

LGALS9

other gene names :

LGALS9; LGALS9; HUAT; LGALS9A; Gal-9

uniprot entry name :

LEG9_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-323

sequence length :

323

sequence :

MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLS
SSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQ
NGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGI
LFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPAN
PAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPF
ITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAF
HLNPRFDENAVVRNTQIDNSW

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Neuroscience

products description :

Binds galactosides. Has high affinity for the Forssman pentasaccharide. May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. Inhibits cell proliferation. It is a ligand for HAVCR2/TIM3. Induces T-helper type 1 lymphocyte (Th1) death. Isoform Short acts as an eosinophil choattractant.

products references :

Molecular definition of a novel human galectin which is immunogenic in patients with Hodgkin's disease.Tuereci O., Schmitt H., Fadle N., Pfreundschuh M., Sahin U.J. Biol. Chem. 272:6416-6422(1997) Human galectin-9 isoform full-length cDNA from gastric adenocarcinoma.Kato S. Human ecalectin, a variant of human galectin-9, is a novel eosinophil chemoattractant produced by T lymphocytes.Matsumoto R., Matsumoto H., Seki M., Hata M., Asano Y., Kanegasaki S., Stevens R.L., Hirashima M.J. Biol. Chem. 273:16976-16984(1998) Cloning and expression of human urate transporter mRNA.Nakajima H., Shichiri M., Hamaguchi T. Homo sapiens galectin-9 (LGALS9) / ecalectin gene, exon 2 through 11.Akiyama S.Genomic organization of the human galectin-9 gene.Graessler J., Spitzenberger F., Schroeder H.E.Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.

ncbi gi num :

102469694

ncbi acc num :

NP_002299.2

ncbi gb acc num :

NM_002308.3

uniprot acc num :

O00182

ncbi mol weight :

66.9kD

ncbi pathways :

Cytokine Signaling In Immune System Pathway (1269310); Immune System Pathway (1269170); Interleukin-2 Signaling Pathway (1269321); Signaling By Interleukins Pathway (1269318)

ncbi summary :

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008]

uniprot summary :

galectin-9: Binds galactosides. Has high affinity for the Forssman pentasaccharide. May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. Inhibits cell proliferation. It is a ligand for HAVCR2/TIM3. Induces T-helper type 1 lymphocyte (Th1) death. Isoform Short acts as an eosinophil chemoattractant. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Unknown function. Chromosomal Location of Human Ortholog: 17q11.2. Cellular Component: cytoplasm; extracellular space; intracellular; nucleus. Molecular Function: carbohydrate binding; disaccharide binding; enzyme binding; galactose binding; signal transducer activity. Biological Process: activation of NF-kappaB transcription factor; chemotaxis; female pregnancy; inflammatory response; maternal process involved in pregnancy; natural killer cell tolerance induction; negative regulation of activated T cell proliferation; negative regulation of chemokine production; negative regulation of interferon-gamma production; negative regulation of mast cell degranulation; negative regulation of natural killer cell mediated cytotoxicity; negative regulation of tumor necrosis factor production; positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation during immune response; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of interleukin-1 beta secretion; positive regulation of interleukin-4 production; positive regulation of NF-kappaB import into nucleus; positive regulation of virion penetration into host cell; regulation of interleukin-4 production; regulation of interleukin-5 production; response to lipopolysaccharide; toll-like receptor 2 signaling pathway; toll-like receptor 4 signaling pathway

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.02 mg (Mammalian-Cell)

price2 :

295

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.05 mg (Mammalian-Cell)

price4 :

575

size5 :

0.5 mg (E-Coli)

price5 :

750

more info or order :

MyBioSource product webpage