INSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKDK
KVDIFGVPYFYTCIIPKSEPDINQNFGGCCMYGGLTFNS
SENERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDY
KARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDL
FPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Human Galectin-9 | MBS1136801
- Recombinant Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LM ...
- Recombinant Human Growth/differentiation factor 11 | MBS1138720
- Recombinant Human Sulfhydryl oxidase 1 (QSOX1) | MBS1140246
- Recombinant Streptococcus pneumoniae serotype 4 Pneumolysin | MBS1141054
