product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Ceratopteris richardii Cyanovirin-N homolog
catalog :
MBS1134791
quantity :
0.01 mg (Yeast)
price :
260 USD
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS1134791 image 1
product information
catalog number :
MBS1134791
products type :
Recombinant Protein
products full name :
Recombinant Ceratopteris richardii Cyanovirin-N homolog
products short name :
[Cyanovirin-N homolog]
other names :
[Cyanovirin-N homolog; Cyanovirin-N homolog]
other gene names :
[CV-N homolog; CV-N homolog]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[28-142aa; Full Length of Mature Protein]
sequence length :
142
sequence :
QCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYY
IGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADG
QYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE
purity :
>85% (SDS-PAGE)
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-Page
other info1 :
Species: Ceratopteris richardii (Triangle waterfern)
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol. Production Note: Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
ncbi gi num :
257096311
ncbi acc num :
P86326.1
uniprot acc num :
P86326
ncbi mol weight :
15,223 Da
uniprot summary :
Mannose-binding lectin.
size1 :
0.01 mg (Yeast)
price1 :
260 USD
size2 :
0.05 mg (Yeast)
price2 :
360
size3 :
0.1 mg (Yeast)
price3 :
595
size4 :
0.2 mg (Yeast)
price4 :
965
size5 :
0.5 mg (Yeast)
price5 :
1345
size6 :
1 mg (Yeast)
price6 :
2065
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!