protein

Recombinant Bovine Interferon tau-1

MBS1131960

0.05 mg (Yeast)

190 USD

Recombinant Protein

Recombinant Bovine Interferon tau-1

Interferon tau-1

Antiluteolysin; Trophoblast antiluteolytic protein; Trophoblast protein 1; TP-1Trophoblastin

interferon tau-2; Interferon tau-1; interferon tau-2; Antiluteolysin; Trophoblast antiluteolytic protein; Trophoblast protein 1; TP-1; Trophoblastin

IFNT1

IFNT2; IFNT1; IFNT; TP-1; IFNT1; IFN-tau-c2; IFN-tau-1; TP-1

IFNT1_BOVIN

E Coli or Yeast or Baculovirus or Mammalian Cell

24-195, Mature full length protein.

195

CYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLP
QEMVEGNQLQKDQAISVLHEMLQQCFNLFYTEHSSAAWN
TTLLEQLCTGLQQQLEDLDACLGPVMGEKDSDMGRMGPI
LTVKKYFQGIHVYLKEKEYSDCAWEIIRVEMMRALSSST
TLQKRLRKMGGDLNSL

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Paracrine hormone primarily responsible for maternal recognition of pregnancy. Interacts with endometrial receptors, probably type I interferon receptors, and blocks estrogen receptor expression, preventing the estrogen-induced increase in oxytocin receptor expression in the endometrium. This results in the suppression of the pulsatile endometrial release of the luteolytic hormone prostaglandin F2-alpha, hindering the regression of the corpus luteum (luteolysis) and therefore a return to ovarian cyclicity. This, and a possible direct effect of IFN-tau on prostaglandin synthesis, leads in turn to continued ovarian progesterone secretion, which stimulates the secretion by the endometrium of the nutrients required for the growth of the conceptus. In summary, displays particularly high antiviral and antiproliferative potency concurrently with particular weak cytotoxicity, high antiluteolytic activity and immunomodulatory properties. In contrast with other IFNs, IFN-tau is not virally inducible.

Molecular cloning and characterization of complementary deoxyribonucleic acids corresponding to bovine trophoblast protein-1 a comparison with ovine trophoblast protein-1 and bovine interferon-alpha II.Imakawa K., Hansen T.R., Malathy P.-V., Anthony R.V., Polites H.G., Marotti K.R., Roberts R.M.Mol. Endocrinol. 3:127-139(1989) Structure of an interferon-alpha 2 gene expressed in the bovine conceptus early in gestation.Stewart H.J., McCann S.H., Flint A.P.F.J. Mol. Endocrinol. 4:275-282(1990) The genes for the trophoblast interferons and the related interferon-alpha II possess distinct 5'-promoter and 3'-flanking sequences.Hansen T.R., Leaman D.W., Cross J.C., Mathialagan N., Bixby J.A., Roberts R.M.J. Biol. Chem. 266:3060-3067(1991) Stewart H.J. Roberts R.M.Cloning bovine interferon-tau genes and characterizing their transcriptional expression during early pregnancy.Chung Y.G., Seidel G.E. Jr.The expressed genes for bovine interferon-tau identification and expression during conceptus development.Larson S.F., Liu L., Winkelman G.L., Kubisch H.M., Bixby J.A., Roberts R.M., Ealy A.D.A three-dimensional model of interferon-tau.Senda T., Saitoh S., Mitsui Y., Li J., Roberts R.M.J. Interferon Cytokine Res. 15:1053-1060(1995) IFN-tau a novel subtype I IFN1. Structural characteristics, non-ubiquitous expression, structure-function relationships, a pregnancy hormonal embryonic signal and cross-species therapeutic potentialities.Martal J.L., Chene N.M., Huynh L.P., L'Haridon R.M., Reinaud P.B., Guillomot M.W., Charlier M.A., Charpigny S.Y.Biochimie 80:755-777(1998)

269973909

NP_001015511.3

NM_001015511.3

P15696

23.8kD

0.05 mg (Yeast)

190 USD

0.05 mg (E-Coli)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (Yeast)

750